Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein SARS2 M (Membrane glycoprotein) Full Length (CAT#: MPC2292K) Made to Order

This product is a made-to-order SARS2 M membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • SARS2
  • Target Protein
  • M
  • Protein Length
  • Full length
  • Protein Class
  • Host-virus interaction
  • TMD
  • 3
  • Sequence
  • MSDSNGTITVEELKKLLEQWNLVIGFLFLTWICLLQFAYANRNRFLYIIK
    LIFLWLLWPVTLACFVLAAVYRINWITGGIAIAMACLVGLMWLSYFIASF
    RLFARTRSMWSFNPETNILLNVPLHGTILTRPLLESELVIGAVILRGHLR
    IAGHHLGRCDIKDLPKEITVATSRTLSYYKLGASQRVAGDSGFAAYSRYR
    IGNYKLNTDHSSSSDNIALLVQ

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • M
  • Full Name
  • Membrane glycoprotein
  • Introduction
  • Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for invasion of host cells. Once inside the cell the infecting RNA is used to encode structural proteins that make up virus particles, nonstructural proteins that direct virus assembly, transcription, replication and host control and accessory proteins whose function has not been determined.~ The structural proteins of SARS-CoV-2 include the envelope protein (E), spike or surface glycoprotein (S), membrane protein (M) and the nucleocapsid protein (N). The membrane protein is a transmembrane glycoprotein, is the most abundant structural protein in the virus particle and has been suggested as an antiviral drug target.
  • Alternative Names
  • M; ORF5; structural protein; Membrane glycoprotein

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us