Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsWith over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications. Highlights
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
HighlightsWith deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
HighlightsGet a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
HighlightsIntroduction of OTOP3
OTOP3 is a transmembrane protein belonging to the proton channel otopetrin family and is encoded by the gene OTOP3. OTOP3 biased expression is only observed in the duodenum (RPKM 38.1) and small intestine (RPKM 6.4). A preliminary secondary structure prediction of OTOP3 based on the human, mouse, rat, zebrafish, and fugu protein sequences suggested a topology of 12 transmembrane domains (TM) with cytosolic amino and carboxy termini. OTOP3 has proton channel activity, which enables the diffusion of hydrogen ions through the channel. Additionally, it also has a nucleic acid binding activity. At present, no alternative transcript variant of OTOP3 has been reported.
| Basic Information of OTOP3 | |
| Protein Name | Proton channel OTOP3 |
| Gene Name | OTOP3 |
| Aliases | Otopetrin-3 |
| Organism | Homo sapiens (Human) |
| UniProt ID | Q7RTS5 |
| Transmembrane Times | 12 |
| Length (aa) | 596 |
| Sequence | MGRGARAAAAQSRWGRASRASVSPGRTIRSAPAVGEAQETEAAPEKENRVDVGAEERAAATRPRQKSWLVRHFSLLLRRDRQAQKAGQLFSGLLALNVVFLGGAFICSMIFNKVAVTLGDVWILLATLKVLSLLWLLYYVASTTRRPHAVLYQDPHAGPLWVRGSLVLFGSCTFCLNIFRVGYDVSHIRCKSQLDLVFSVIEMVFIGVQTWVLWKHCKDCVRVQTNFTRCGLMLTLATNLLLWVLAVTNDSMHREIEAELGILMEKSTGNETNTCLCLNATACEAFRRGFLMLYPFSTEYCLICCAVLFVMWKNVGRHVAPHMGAHPATAPFHLHGAIFGPLLGLLVLLAGVCVFVLFQIEASGPAIACQYFTLYYAFYVAVLPTMSLACLAGTAIHGLEERELDTVKNPTRSLDVVLLMGAALGQMGIAYFSIVAIVAKRPHELLNRLILAYSLLLILQHIAQNLFIIEGLHRRPLWETVPEGLAGKQEAEPPRRGSLLELGQGLQRASLAYIHSYSHLNWKRRALKEISLFLILCNITLWMMPAFGIHPEFENGLEKDFYGYQIWFAIVNFGLPLGVFYRMHSVGGLVEVYLGA |
Similar to OTOP2, OTOP3 is also identified for the first time because of its essential role in the vestibular system. OTOP3 functions remain unknown clearly. But as a proton-selective channel, OTOP3 can specifically control the transportation of protons into cells, which is generally indispensable in cell types that make use of changes in intracellular pH or to regulate biochemical or developmental processes. As a type of otopetrins, OTOP3 is essential for normal formation of otoliths/otoconia in the inner ear. Otoconia are complex calcium carbonate biominerals in the utricle and saccule of the vertebrate inner ear, which are essential for the normal sensation of linear acceleration and gravity. Degeneration or displacement of otoconia can lead to vertigo and loss of balance. Notably, the Otop2-Otop3 gene tandem is physically clustered (head-to-tail) with the Usher syndrome (USH) subtype 1G gene (USH1G), which may reflect lineage-specific genomic features and gene associations worthy of exploration.
Fig.1 Part of the vestibular system.
Application of OTOP3 Membrane Protein in Literature
This article sets up a framework for studying the probable interaction(s) of Otop and Ush1g in developmental pathways and clarifies the evolutionary history of the vertebrate Ush1g and Otop families.
This article defines a novel gene family (Otop3 and Otop2, Otop1 and Otop1-like paralogues) with homology to the D. melanogaster and C. elegans DUF270 genes.
This article confirms that the distinct identity of ODP proteins is three "Otopetrin Domains" that are highly conserved between arthropods, vertebrates, and nematodes.
This report demonstrates that otopetrin family is of evolutionary conservation and it may have widespread tissue distribution, suggesting a broad role of proton channels in pathophysiology and physiology.
OTOP3 Preparation Options
During the past years, Creative Biolabs has developed the versatile Magic™ membrane protein production platform to provide high-quality membrane protein preparation service. Our experienced scientists will do their best to help you find a perfect match for worldwide customers in reconstitution forms as well as multiple active formats. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-OTOP3 antibody development services.
As a leader in membrane protein preparation field, Creative Biolabs has successfully generated many functional membrane proteins for our global customers. We are dedicated to providing first-class membrane protein production service using a variety of strategies. Based on our leading-edge platform, we have successfully produced, purified, stabilized and characterized many challenging membrane protein targets for global customers. If you are interested in the service we can provide, please feel free to contact us for more information.
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.
