Close

OTOP3 Membrane Protein Introduction

Introduction of OTOP3

OTOP3 is a transmembrane protein belonging to the proton channel otopetrin family and is encoded by the gene OTOP3. OTOP3 biased expression is only observed in the duodenum (RPKM 38.1) and small intestine (RPKM 6.4). A preliminary secondary structure prediction of OTOP3 based on the human, mouse, rat, zebrafish, and fugu protein sequences suggested a topology of 12 transmembrane domains (TM) with cytosolic amino and carboxy termini. OTOP3 has proton channel activity, which enables the diffusion of hydrogen ions through the channel. Additionally, it also has a nucleic acid binding activity. At present, no alternative transcript variant of OTOP3 has been reported.

Basic Information of OTOP3
Protein Name Proton channel OTOP3
Gene Name OTOP3
Aliases Otopetrin-3
Organism Homo sapiens (Human)
UniProt ID Q7RTS5
Transmembrane Times 12
Length (aa) 596
Sequence MGRGARAAAAQSRWGRASRASVSPGRTIRSAPAVGEAQETEAAPEKENRVDVGAEERAAATRPRQKSWLVRHFSLLLRRDRQAQKAGQLFSGLLALNVVFLGGAFICSMIFNKVAVTLGDVWILLATLKVLSLLWLLYYVASTTRRPHAVLYQDPHAGPLWVRGSLVLFGSCTFCLNIFRVGYDVSHIRCKSQLDLVFSVIEMVFIGVQTWVLWKHCKDCVRVQTNFTRCGLMLTLATNLLLWVLAVTNDSMHREIEAELGILMEKSTGNETNTCLCLNATACEAFRRGFLMLYPFSTEYCLICCAVLFVMWKNVGRHVAPHMGAHPATAPFHLHGAIFGPLLGLLVLLAGVCVFVLFQIEASGPAIACQYFTLYYAFYVAVLPTMSLACLAGTAIHGLEERELDTVKNPTRSLDVVLLMGAALGQMGIAYFSIVAIVAKRPHELLNRLILAYSLLLILQHIAQNLFIIEGLHRRPLWETVPEGLAGKQEAEPPRRGSLLELGQGLQRASLAYIHSYSHLNWKRRALKEISLFLILCNITLWMMPAFGIHPEFENGLEKDFYGYQIWFAIVNFGLPLGVFYRMHSVGGLVEVYLGA

Function of OTOP3 Membrane Protein


Similar to OTOP2, OTOP3 is also identified for the first time because of its essential role in the vestibular system. OTOP3 functions remain unknown clearly. But as a proton-selective channel, OTOP3 can specifically control the transportation of protons into cells, which is generally indispensable in cell types that make use of changes in intracellular pH or to regulate biochemical or developmental processes. As a type of otopetrins, OTOP3 is essential for normal formation of otoliths/otoconia in the inner ear. Otoconia are complex calcium carbonate biominerals in the utricle and saccule of the vertebrate inner ear, which are essential for the normal sensation of linear acceleration and gravity. Degeneration or displacement of otoconia can lead to vertigo and loss of balance. Notably, the Otop2-Otop3 gene tandem is physically clustered (head-to-tail) with the Usher syndrome (USH) subtype 1G gene (USH1G), which may reflect lineage-specific genomic features and gene associations worthy of exploration.

Part of the vestibular system. Fig.1 Part of the vestibular system.

Application of OTOP3 Membrane Protein in Literature

  1. Hurle B., et al. Lineage-specific evolution of the vertebrate Otopetrin gene family revealed by comparative genomic analyses. BMC Evol Biol. 2011, 11: 23. PubMed ID: 21261979

    This article sets up a framework for studying the probable interaction(s) of Otop and Ush1g in developmental pathways and clarifies the evolutionary history of the vertebrate Ush1g and Otop families.

  2. Hurle B., et al. Non-syndromic vestibular disorder with otoconial agenesis in tilted/mergulhador mice caused by mutations in otopetrin 1. Hum Mol Genet. 2003, 12(7): 777-89. PubMed ID: 12651873

    This article defines a novel gene family (Otop3 and Otop2, Otop1 and Otop1-like paralogues) with homology to the D. melanogaster and C. elegans DUF270 genes.

  3. Hughes I., et al. Identification of the Otopetrin Domain, a conserved domain in vertebrate otopetrins and invertebrate otopetrin-like family members. BMC Evol Biol. 2008, 8: 41. PubMed ID: 18254951

    This article confirms that the distinct identity of ODP proteins is three "Otopetrin Domains" that are highly conserved between arthropods, vertebrates, and nematodes.

  4. Tu Y.H., et al. An evolutionarily conserved gene family encodes proton-selective ion channels. Science. 2018, 359(6379): 1047-1050. PubMed ID: 29371428

    This report demonstrates that otopetrin family is of evolutionary conservation and it may have widespread tissue distribution, suggesting a broad role of proton channels in pathophysiology and physiology.

OTOP3 Preparation Options

During the past years, Creative Biolabs has developed the versatile MemDX™ membrane protein production platform to provide high-quality membrane protein preparation service. Our experienced scientists will do their best to help you find a perfect match for worldwide customers in reconstitution forms as well as multiple active formats. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-OTOP3 antibody development services.


As a leader in membrane protein preparation field, Creative Biolabs has successfully generated many functional membrane proteins for our global customers. We are dedicated to providing first-class membrane protein production service using a variety of strategies. Based on our leading-edge platform, we have successfully produced, purified, stabilized and characterized many challenging membrane protein targets for global customers. If you are interested in the service we can provide, please feel free to contact us for more information.


All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us