Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Recombinant Full Length Human CD9 Protein (Nanodisc, Rho1D4 Tag) (CAT#: SYF-0926-CW85)

Recombinant full-length human CD9 protein reconstituted in a nanodisc membrane-mimetic system for biochemical, binding, and assay development applications.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CD9
  • Protein Length
  • Full-length
  • Protein Class
  • Tetraspanin
  • Molecular Weight
  • 25 kDa (homodimer)
  • Sequence
  • MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV

Product Description

  • Expression Systems
  • HEK293 cells
  • Tag
  • The construct includes a C-terminal Rho1D4 tag.
  • Protein Format
  • Nanodisc
  • Purity
  • The protein purity is greater than 90% as determined by SDS-PAGE.

Target

  • Target Protein
  • CD9
  • Full Name
  • CD9 molecule
  • Introduction
  • Tetraspanin-29 (CD9) is a full-length human tetraspanin. CD9 antigen is a member of the tetraspanin family of proteins, which are involved in various biological processes, including cell adhesion, paranodal junction function, cell motility, and tumour metastasis. In addition to these functions, CD9 plays a role in mechanisms related to fertility, such as sperm-egg fusion. The protein is supplied in an MSP-free, copolymer-stabilized native-lipid nanodisc. The preparation uses 2-step purification.
  • Alternative Names
  • BA2, P24, TSPAN29, MRP-1, MIC3

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us