Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Recombinant Full Length Human SLC25A33 Protein (Nanodisc, Rho1D4 Tag) (CAT#: SYF-0926-CW178)

Recombinant full-length human SLC25A33 protein reconstituted in a nanodisc membrane-mimetic system for biochemical, binding, and assay development applications.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SLC25A33
  • Protein Length
  • Full-length
  • Protein Class
  • Mitochondrial Carrier
  • Molecular Weight
  • 37 kDa
  • Sequence
  • MATGGQQKENTLLHLFAGGCGGTVGAIFTCPLEVIKTRLQSSRLALRTVYYPQVHLGTISGAGMVRPTSVTPGLFQVLKSILEKEGPKSLFRGLGPNLVGVAPSRAVYFACYSKAKEQFNGIFVPNSNIVHIFSAGSAAFITNSLMNPIWMVKTRMQLEQKVRGSKQMNTLQCARYVYQTEGIRGFYRGLTASYAGISETIICFAIYESLKKYLKEAPLASSANGTEKNSTSFFGLMAAAALSKGCASCIAYPHEVIRTRLREEGTKYKSFVQTARLVFREEGYLAFYRGLFAQLIRQIPNTAIVLSTYELIVYLLEDRTQ

Product Description

  • Expression Systems
  • HEK293 cells
  • Tag
  • The construct includes a C-terminal Rho1D4 tag.
  • Protein Format
  • Nanodisc
  • Purity
  • The protein purity is greater than 90% as determined by SDS-PAGE.

Target

  • Target Protein
  • SLC25A33
  • Full Name
  • solute carrier family 25 member 33
  • Introduction
  • Solute carrier family 25 member 33 (SLC25A33) is a full-length human slc transporter. The SLC25A33 gene encodes a mitochondrial solute carrier protein, primarily functioning as a pyrimidine nucleotide transporter that facilitates the bidirectional exchange of uracil and thymine nucleotides across the inner mitochondrial membrane to maintain organellar nucleotide pools. From a clinical perspective, dysregulation or mutations in SLC25A33 are associated with mitochondrial DNA depletion syndromes and impaired cellular proliferation, as the transporter is critical for DNA synthesis, repair, and overall metabolic homeostasis within the mitochondria. The protein is supplied in an MSP-free, copolymer-stabilized native-lipid nanodisc. The preparation uses 2-step purification.
  • Alternative Names
  • MGC4399, BMSC-MCP, PNC1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us