Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Recombinant Full Length Human TMEM175 Protein (Biotinylated Nanodisc, Rho1D4 Tag) (CAT#: SYF-0926-CW201)

Recombinant full-length human TMEM175 protein reconstituted in a biotinylated nanodisc membrane-mimetic system for immobilization, binding, detection, and assay development applications; the copolymer is biotinylated while the protein itself remains unmodified.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TMEM175
  • Protein Length
  • Full-length
  • Protein Class
  • Lysosomal Ion Channel
  • Molecular Weight
  • 57 kDa
  • Sequence
  • MSQPRTPEQALDTPGDCPPGRRDEDAGEGIQCSQRMLSFSDALLSIIATVMILPVTHTEISPEQQFDRSVQRLLATRIAVYLMTFLIVTVAWAAHTRLFQVVGKTDDTLALLNLACMMTITFLPYTFSLMVTFPDVPLGIFLFCVCVIAIGVVQALIVGYAFHFPHLLSPQIQRSAHRALYRRHVLGIVLQGPALCFAAAIFSLFFVPLSYLLMVTVILLPYVSKVTGWCRDRLLGHREPSAHPVEVFSFDLHEPLSKERVEAFSDGVYAIVATLLILDICEDNVPDPKDVKERFSGSLVAALSATGPRFLAYFGSFATVGLLWFAHHSLFLHVRKATRAMGLLNTLSLAFVGGLPLAYQQTSAFARQPRDELERVRVSCTIIFLASIFQLAMWTTALLHQAETLQPSVWFGGREHVLMFAKLALYPCASLLAFASTCLLSRFSVGIFHLMQIAVPCAFLLLRLLVGLALATLRVLRGLARPEHPPPAPTGQDDPQSQLLPAPC

Product Description

  • Expression Systems
  • HEK293 cells
  • Tag
  • The construct includes a C-terminal Rho1D4 tag. The copolymer is biotinylated; the protein itself is unmodified.
  • Protein Format
  • Nanodisc
  • Purity
  • The protein purity is greater than 90% as determined by SDS-PAGE.

Target

  • Target Protein
  • TMEM175
  • Full Name
  • transmembrane protein 175
  • Introduction
  • Endosomal/lysosomal proton channel TMEM175 (TMEM175) is a full-length human ion channel. TMEM175 is a constitutively active lysosomal potassium (K) channel that regulates organellar membrane potential and luminal pH stability, facilitating optimal enzymatic activity and autophagosome-lysosome fusion. It acts as a critical ion flux regulator to prevent lysosomal hyperpolarization during proton import by the v-ATPase. The surrounding nanodisc copolymer is biotinylated to support direct surface immobilization without modifying the protein itself. The preparation uses 2-step purification.
  • Alternative Names
  • MGC4618

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us