Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Recombinant Full Length Human TNF Protein (Nanodisc, Rho1D4 Tag) (CAT#: SYF-0926-CW210)

Recombinant full-length human TNF protein reconstituted in a nanodisc membrane-mimetic system for biochemical, binding, and assay development applications.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TNF
  • Protein Length
  • Full-length
  • Protein Class
  • Cytokine
  • Molecular Weight
  • 27 kDa (homotrimer)
  • Sequence
  • MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL

Product Description

  • Expression Systems
  • HEK293 cells
  • Tag
  • The construct includes a C-terminal Rho1D4 tag.
  • Protein Format
  • Nanodisc
  • Purity
  • The protein purity is greater than 90% as determined by SDS-PAGE.

Target

  • Target Protein
  • TNF
  • Full Name
  • tumor necrosis factor
  • Introduction
  • Tumor necrosis factor (TNF) is a full-length human cytokine. TNF is a pro-inflammatory cytokine that signals through TNF receptors and coordinates immune and inflammatory responses. The protein is supplied in an MSP-free, copolymer-stabilized native-lipid nanodisc. The preparation uses 2-step purification.
  • Alternative Names
  • TNFSF2, DIF, TNF-alpha, TNFA

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us