Close

5-HTR3B Membrane Protein Introduction

Introduction of 5-HTR3B

5-hydroxytryptamine receptor 3B (5-HTR3B), also known as serotonin receptor 3B, is one of the type 3 receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone which acts as a neurotransmitter, a hormone, and a mitogen. The 5-HTR3B receptor is a ligand-gated ion channel and in human is encoded by the HTR3B gene. The 5-HTR3B receptors are co-expressed with the 5-HTR3A subunit in the amygdala, hippocampus and caudate. They are also found in the kidney and testis as well as in monocytes of the spleen, small and large intestine, prostate, uterus, ovary, and placenta.

Basic Information of 5-HTR3B
Protein Name 5-hydroxytryptamine receptor 3B
Gene Name HTR3B
Aliases Serotonin receptor 3B, 5-HT3-B, 5-HT3B
Organism Homo sapiens (Human)
UniProt ID O95264
Transmembrane Times 4
Length (aa) 430
Sequence MIVYFPGILATDTHHPQDSALYHLSKQLLQKYHKEVRPVYNWTKATTVYLDLFVHAILDVDAENQILKTSVWYQEVWNDEFLSWNSSMFDEIREISLPLSAIWAPDIIINEFVDIERYPDLPYVYVNSSGTIENYKPIQVVSACSLETYAFPFDVQNCSLTFKSILHTVEDVDLAFLRSPEDIQHDKKAFLNDSEWELLSVSSTYSILQSSAGGFAQIQFNVVMRRHPLVYVVSLLIPSIFLMLVDLGSFYLPPNCRARIVFKTSVLVGYTVFRVNMSNQVPRSVGSTPLIGHFFTICMAFLVLSLAKSIVLVKFLHDEQRGGQEQPFLCLRGDTDADRPRVEPRAQRAVVTESSLYGEHLAQPGTLKEVWSQLQSISNYLQTQDQTDQQEAEWLVLLSRFDRLLFQSYLFMLGIYTITLCSLWALWGGV

Function of 5-HTR3B Membrane Protein

5-hydroxytryptamine or 5-HTR, also known as the neurotransmitter serotonin receptor, mediates rapid excitatory responses through 5-HTR3 receptors (ligand-gated channels). The 5-HTR3B receptor is a cation-specific, but otherwise relatively nonselective ion channel, which causes fast, depolarizing responses upon activation. Activation of 5-HTR3 receptors generates a range of effects, such as membrane depolarization and increase in intracellular Ca2+, Ca2+ influx into lymphocytes, modulation of neurotransmitter release, excitation of central and peripheral neurons, and release of 5-HTR from enterochromaffin cells of the small intestine. Studies indicated that 5-HTR3B may play a role in tissue-specific functional changes of 5-HTR3-mediated signaling and/or modulation. Although 5-HTR3B seems to be unable to function as an α-subunit in homomers or in combination with nicotinic ACh receptor β-subunits, it is supposed to be involved in modifying 5-HTR3A receptor function and altering the desensitization of 5-HTR3A receptors.

Structure of mouse 5-HTR3B membrane protein. Fig.1 Structure of mouse 5-HTR3B membrane protein.

Application of 5-HTR3B Membrane Protein in Literature

  1. Farhat K., et al. Association of anti-emetic efficacy of Ondansetron with 18792A>G polymorphism in a drug target gene 5-HT3B in Pakistani population. J Pak Med Assoc. 2018, 68(5):733-736. PubMed ID: 29885172

    The authors of this study focused on the evaluation of the association of anti-emetic efficacy of ondansetron with 18792A>G polymorphism in the target gene of 5-hydroxytryptamine type 3 subtype B.

  2. Nakamura Y., et al. Yokukansan contains compounds that antagonize the 5-HT3 receptor. Phytomedicine. 2018, 43:120-125. PubMed ID: 29747744

    The results attempted to evaluate the effect of seven alkaloids in Uncaria hook on the hydroxytryptamine type-3 (5-HT3) receptor ion channel and showed that six alkaloids weakly inhibited the 5-HT-mediated 5-HT3A and/or 5-HT3AB receptor current.

  3. López-Morales P., et al. Genetic Factors Associated with Postoperative Nausea and Vomiting: a Systematic Review. J Gastrointest Surg. 2018, 22(9):1645-1651. PubMed ID: 29725907

    The findings of this study indicated that the AAG deletion in both alleles of the 5-HT3B receptor gene appeared to be related to a higher incidence of PONV.

  4. Nakamura Y., et al. Direct modification of the 5-HT3 receptor current by some anticancer drugs. Eur J Pharmacol. 2018, 821:21-28. PubMed ID: 29277715

    Authors of this study suggested that over 25% of anticancer drugs tested in this study inhibited or potentiated the 5-HT3 receptor current.

  5. Kim M.S., et al. Association of 5-HT3B Receptor Gene Polymorphisms with the Efficacy of Ondansetron for Postoperative Nausea and Vomiting. Yonsei Med J. 2015, 56(5):1415-20. PubMed ID: 26256989

    The findings of this article suggested that the response to ondansetron for PONV was significantly influenced by the -100_-102AAG deletion polymorphisms of the 5-HT3B gene.

5-HTR3B Preparation Options

Our MemDX™ membrane protein production platform provides you with many flexible options, which enables robust reconstitution forms as well as multiple active formats for membrane proteins. To obtain the soluble and functional target protein of your interest, our experienced scientists offer customized services with fast turnaround times. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-5-HTR3B antibody development services.


Creative Biolabs has established high-quality and efficient procedures for membrane protein preparation, to provide a comprehensive solution for membrane protein studies. Our scientists are devoting themselves to solve the toughest problems in membrane protein preparation. Please feel free to contact us for technical support.


All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us