Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsWith over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications. Highlights
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
HighlightsWith deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
HighlightsGet a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
HighlightsIntroduction of CACNG5
Encoded by CACNG5 gene, CACNG5 belongs to the neuronal calcium channel gamma subunit subfamily which has been extensively studied during the past few decades because it offers numerous possibilities for therapeutic applications. It is one of the five subunits of L-type calcium channels. Recent studies show it is associated with bipolar disorder and schizophrenia.
| Basic Information of CACNG5 | |
| Protein Name | Voltage-dependent calcium channel gamma-5 subunit |
| Gene Name | CACNG5 |
| Aliases | NA |
| Organism | Homo sapiens (Human) |
| UniProt ID | Q9UF02 |
| Transmembrane Times | 4 |
| Length (aa) | 275 |
| Sequence | MSACGRKALTLLSSVFAVCGLGLLGIAVSTDYWLYLEEGVIVPQNQSTEIKMSLHSGLWRVCFLAGEERGRCFTIEYVMPMNTQLTSESTVNVLKMIRSATPFPLVSLFFMFIGFILNNIGHIRPHRTILAFVSGIFFILSGLSLVVGLVLYISSINDEMLNRTKDAETYFNYKYGWSFAFAAISFLLTESAGVMSVYLFMKRYTAEDMYRPHPGFYRPRLSNCSDYSGQFLHPDAWVRGRSPSDISSEASLQMNSNYPALLKCPDYDQMSSSPC |
Function of CACNG5 Membrane Protein
Mapping to chromosome 17q24, CACNG5 gene encodes an integral membrane protein that was originally isolated as the regulatory gamma subunit of voltage-dependent Ca2+ channels. As a type II transmembrane AMPA receptor regulatory protein (TARP), CACNG5 can regulate the gating properties of AMPA-selective glutamate receptors (AMPARs) by accelerating their rates of activation, deactivation, and desensitization. It is commonly expressed in lots of tissues, such as the brain, lymph node, as well as spleen. Recent studies show that it may contribute to the risk of schizophrenia. It is documented that the lncRNA LINC00880 targeting CACNG5 can inhibit cell apoptosis and promote proliferation, migration, and invasion in spinal cord ependymoma (SCE) through the MAPK signaling pathway.
Fig.1 Structure of p38 MAPK Pathway.
Application of CACNG5 Membrane Protein in Literature
This article analyses the positive expression of the CACNG5 protein, LINC00880, and MAPK signaling pathway-related proteins in spinal cord ependymoma (SCE) tissues. These results demonstrate that lncRNA LINC00880 targeting CACNG5 inhibits cell apoptosis and promotes proliferation, migration, and invasion in SCE through the MAPK signaling pathway.
Authors conduct a large-scale association study in Han Chinese individuals. The data suggest the SNP rs17645023 located in the intergenic region of CACNG4 and CACNG5 is identified to be significantly associated with schizophrenia.
Authors in this group conduct genome-wide association studies and compare marker allele frequencies between the samples of UK bipolar and schizophrenic. These results indicate that CACNG5 plays a key role in voltage-dependent calcium channel genes in the susceptibility to bipolar disorder and/or schizophrenia.
CACNG5 Preparation Options
To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-CACNG5 antibody development services.
As a forward-looking research institute as well as a leading custom service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.
