Recombinant Streptomyces plicatus Outer capsid glycoprotein vp7 (45-313 aa) [His-Tag], Yeast (CAT#: GP02-075J)

Product Overview	Recombinant Streptomyces plicatus Outer capsid glycoprotein vp7 (45-313 aa) was expressed in Yeast with a 6xHis-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source	Yeast
Species	Streptomyces plicatus
Fragment	45-313 aa
Sequence	APVKQGPTSVAYVEVNNNSMLNVGKYTLADGGGNAFDVAVIFAANINYDTGTKTAYLHFNENVQRVLDNAVTQIRPLQQQGIKVLLSVLGNHQGAGFANFPSQQAASAFAKQLSDAVAKYGLDGVDFDDEYAEYGNNGTAQPNDSSFVHLVTALRANMPDKIISLYNIGPAASRLSYGGVDVSDKFDYAWNPYYGTWQVPGIALPKAQLSPAAVEIGRTSRSTVADLARRTVDEGYGVYLTYNLDGGDRTADVSAFTRELYGSEAVRTP
Tag	6xHis-tag at the C-terminus
Predicted MW	31.2 kDa
Purity	>95%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	Outer capsid glycoprotein vp7
Full Name	Outer capsid glycoprotein vp7
Uniprot ID	P04067
Background	This protein is a calcium-binding protein that interacts with rotavirus cell receptors once the initial attachment by VP4 has been achieved. Rotavirus attachment and entry into the host cell probably involves multiple sequential contacts between the outer capsid proteins VP4 and VP7, and the cell receptors. Following entry into the host cell, low intracellular or intravesicular Ca2+ concentration probably causes the calcium-stabilized VP7 trimers to dissociate from the virion. This step is probably necessary for the membrane-disrupting entry step and the release of VP4, which is locked onto the virion by VP7.
Alternate Names	DI-N-acetylchitobiosyl beta-N-acetylglucosaminidase H; Endoglycosidase H; Short name:; Endo H; Mannosyl-glycoprotein endo-beta-N-acetyl-glucosaminidase H