0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Streptomyces plicatus Outer capsid glycoprotein vp7 (45-313 aa) [His-Tag], Yeast (CAT#: GP02-075J)

Datasheet
SizeQtyAdd To Basket
100 μg

Product Overview Recombinant Streptomyces plicatus Outer capsid glycoprotein vp7 (45-313 aa) was expressed in Yeast with a 6xHis-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source Yeast
Species Streptomyces plicatus
Fragment 45-313 aa
Sequence APVKQGPTSVAYVEVNNNSMLNVGKYTLADGGGNAFDVAVIFAANINYDTGTKTAYLHFNENVQRVLDNAVTQIRPLQQQGIKVLLSVLGNHQGAGFANFPSQQAASAFAKQLSDAVAKYGLDGVDFDDEYAEYGNNGTAQPNDSSFVHLVTALRANMPDKIISLYNIGPAASRLSYGGVDVSDKFDYAWNPYYGTWQVPGIALPKAQLSPAAVEIGRTSRSTVADLARRTVDEGYGVYLTYNLDGGDRTADVSAFTRELYGSEAVRTP
Tag 6xHis-tag at the C-terminus
Predicted MW 31.2 kDa
Purity >95%, determined by SDS-PAGE.
Conjugation Unconjugated
Target Outer capsid glycoprotein vp7
Full Name Outer capsid glycoprotein vp7
Uniprot ID P04067
Background This protein is a calcium-binding protein that interacts with rotavirus cell receptors once the initial attachment by VP4 has been achieved. Rotavirus attachment and entry into the host cell probably involves multiple sequential contacts between the outer capsid proteins VP4 and VP7, and the cell receptors. Following entry into the host cell, low intracellular or intravesicular Ca2+ concentration probably causes the calcium-stabilized VP7 trimers to dissociate from the virion. This step is probably necessary for the membrane-disrupting entry step and the release of VP4, which is locked onto the virion by VP7.
Alternate Names DI-N-acetylchitobiosyl beta-N-acetylglucosaminidase H; Endoglycosidase H; Short name:; Endo H; Mannosyl-glycoprotein endo-beta-N-acetyl-glucosaminidase H
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on