Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsWith over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications. Highlights
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
HighlightsWith deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
HighlightsGet a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
HighlightsIntroduction of GNRHR2
The putative gonadotropin-releasing hormone II receptor (GNRHR2) is a receptor protein encoded by gene GNRHR2. This receptor is a member of the G-protein coupled receptor 1 (GPCR1) family and expressed in many tissues. Putative receptor for gonadotropin releasing hormone II (GnRH II) is most probably non-functional.
| Protein Name | Putative gonadotropin-releasing hormone II receptor |
| Gene Name | GNRHR2 |
| Aliases | GnRH II receptor, GnRH-II-R, GNRR2, Type II GnRH receptor |
| Organism | Homo sapiens (Human) |
| UniProt ID | Q96P88 |
| Transmembrane Times | 5 |
| Length (aa) | 292 |
| Sequence |
MSAGNGTPWDATWNITVQWLAVDIACRTLMFLKLMATYSAAFLPVVIGLDRQAAVLNPLG SRSGVRKLLGAAWGLSFLLAFPQLFLFHTVHCAGPVPFTQCVTKGSFKAQWQETTYNLFT FCCLFLLPLTAMAICYSRIVLSVSRPQTRKGSHAPAGEFALPRSFDNCPRVRLRALRLAL LILLTFILCWTPYYLLGMWYWFSPTMLTEVPPSLSHILFLLGLLNAPLDPLLYGAFTLGC RRGHQELSIDSSKEGSGRMLQEEIHAFRQLEVQKTVTSRRAGETKGISITSI |
Function of GNRHR2 Membrane Protein
GNRHR2 is a receptor for gonadotropin-releasing hormone II (GnRH2). The role of GnRH2 and its receptors in mammals has been elusive, probably due to the lack of ligands and receptors in common laboratory models. In fact, GnRH2 and its receptors are not physiological regulators of gonadotropin secretion in mammals. In peripheral tissues, GnRH2 and its receptors are new regulators of the reproductive organs.
Application of GNRHR2 Membrane Protein in Literature
This article reports that GnRH2 and its receptors can coordinate the interaction between nutritional status and sexual behavior in female brains, helping to mediate female placental function, implantation and ovarian steroidogenesis.
This article reveals that GNRH2 and GNRHR2 mediate LH-independent testosterone secretion in pig testes.
This research demonstrates that NF-κB, SP1/3 and overlapping EGR1/SP1/3 binding sites are pivotal to the expression of the porcine Gnrhr2 gene in ST cells.
GNRHR2 Preparation Options
To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-GNRHR2 antibody development services.
As a forward-looking research institute as well as a leading custom service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.
