Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CD207 (CD207 molecule) Expressed in NS0 for Antibody Discovery, Partial (64-328aa) (CAT#: MPX0748K)

This product is a 31 kDa Human CD207 membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CD207
  • Protein Length
  • Partial (64-328aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 31 kDa
  • TMD
  • 1
  • Sequence
  • YPRFMGTISDVKTNVQLLKGRVDNISTLDSEIKKNSD
    GMEAAGVQIQMVNESLGYVRSQFLKLKTSVEKANAQIQILTRSWEEVSTL
    NAQIPELKSDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWK
    YFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLI
    YWIGLTKAGMEGDWSWVDDTPFNKVQSVRFWIPGEPNNAGNNEHCGNIKA
    PSLQAWNDAPCDKTFLFICKRPYVPSEP

Product Description

  • Activity
  • Yes
  • Expression Systems
  • NS0
  • Tag
  • 9xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in sterile PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE under reducing conditions and visualized by silver stain
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • CD207
  • Full Name
  • CD207 molecule
  • Introduction
  • The protein encoded by this gene is expressed only in Langerhans cells which are immature dendritic cells of the epidermis and mucosa. It is localized in the Birbeck granules, organelles present in the cytoplasm of Langerhans cells and consisting of superimposed and zippered membranes. It is a C-type lectin with mannose binding specificity, and it has been proposed that mannose binding by this protein leads to internalization of antigen into Birbeck granules and providing access to a nonclassical antigen-processing pathway. Mutations in this gene result in Birbeck granules deficiency or loss of sugar binding activity.
  • Alternative Names
  • CD207; CLEC4K; C-type lectin domain family 4 member K; CD207 antigen, langerin; CD207 molecule, langerin; Langerhans cell specific c-type lectin; CD207 molecule

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us