Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CD300E (CD300e molecule) Expressed in HEK293 for Antibody Discovery, Partial (18-169aa) (CAT#: MPX0760K)

This product is a 44 kDa Human CD300E membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CD300E
  • Protein Length
  • Partial (18-169aa)
  • Protein Class
  • Receptor; Immunity
  • Molecular Weight
  • 44 kDa
  • TMD
  • 1
  • Sequence
  • LKGPGSVTGTAGDSLTVWCQYESMYKGYNKYWC
    RGQYDTSCESIVETKGEEKVERNGRVSIRDHPEALAFTVTMQNLNEDDAG
    SYWCKIQTVWVLDSWSRDPSDLVRVYVSPAITTPRRTTHPATPPIFLVVN
    PGRNLSTGEVLTQNSGFRL

Product Description

  • Activity
  • Yes
  • Expression Systems
  • HEK293
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 200 μg/mL in PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in Tris and NaCl.

Target

  • Target Protein
  • CD300E
  • Full Name
  • CD300e molecule
  • Introduction
  • This gene encodes a member of the CD300 glycoprotein family of cell surface proteins expressed on myeloid cells. The protein interacts with the TYRO protein tyrosine kinase-binding protein and is thought to act as an activating receptor.
  • Alternative Names
  • CD300E; CLM2; CLM-2; IREM2; PIgR2; IREM-2; PIgR-2; CD300LE; CMRF35-A5; CMRF35-like molecule 2; CD300 antigen-like family member E; CD300e antigen; immune receptor expressed on myeloid cells 2; poly-Ig receptor 2; polymeric immunoglobulin receptor 2; CD300e molecule

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us