Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CD300LB (CD300 molecule like family member b) Expressed in E.coli with 10xHis tag at the N-terminus for Antibody Discovery, Partial (18-151aa) (CAT#: MPX4101K)

This product is a 18.8 kDa Human CD300LB membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CD300LB
  • Protein Length
  • Partial (18-151aa)
  • Protein Class
  • Receptor; Immunity
  • Molecular Weight
  • 18.8 kDa
  • TMD
  • 1
  • Sequence
  • IQGPESVRAPEQGSLTVQCHYKQGWETYIKWWCRGVRWDTCKILIETRGSEQGEKSDRVSIKDNQKDRTFTVTMEGLRRDDADVYWCGIERRGPDLGTQVKVIVDPEGAASTTASSPTNSNMAVFIGSHKRNHY

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >85% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • CD300LB
  • Full Name
  • CD300 molecule like family member b
  • Introduction
  • CD300LB is a nonclassical activating receptor of the immunoglobulin (Ig) superfamily expressed on myeloid cells
  • Alternative Names
  • CD300LB; CLM7; CLM-7; IREM3; TREM5; CD300b; IREM-3; TREM-5; CMRF35-A2; CMRF35-like molecule 7; CD300 antigen like family member B; immune receptor expressed on myeloid cells 3; leukocyte mono-Ig-like receptor 5; triggering receptor expressed on myeloid cells 5; CD300 molecule like family member b

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us