Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human FCGRT (Fc fragment of IgG receptor and transporter) Expressed in HEK293 for Antibody Discovery, Partial (24-297aa) (CAT#: MPX0094K)

This product is a 31 kDa Human FCGRT membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • FCGRT
  • Protein Length
  • Partial (24-297aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 31 kDa
  • TMD
  • 1
  • Sequence
  • AESHLSLLYHLTAVSSPAPGTPAFWVS
    GWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLE
    AFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTW
    GGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWK
    EPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFG
    PNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSS

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • 6xHis tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 500 μg/mL in PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • FCGRT
  • Full Name
  • Fc fragment of IgG receptor and transporter
  • Introduction
  • This gene encodes a receptor that binds the Fc region of monomeric immunoglobulin G. The encoded protein transfers immunoglobulin G antibodies from mother to fetus across the placenta. This protein also binds immunoglobulin G to protect the antibody from degradation. Alternative splicing results in multiple transcript variants.
  • Alternative Names
  • FCGRT; FCRN; alpha-chain; IgG receptor FcRn large subunit p51; Fc fragment of IgG, receptor, transporter, alpha; FcRn alpha chain; IgG Fc fragment receptor transporter alpha chain; heavy chain of the major histocompatibility complex class I-like Fc receptor; immunoglobulin receptor, intestinal, heavy chain; major histocompatibility complex class I-like Fc receptor; neonatal Fc receptor; neonatal Fc-receptor for Ig; transmembrane alpha chain of the neonatal receptor; Fc fragment of IgG receptor and transporter

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us