Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human MGST1 (Microsomal glutathione S-transferase 1) Full Length (CAT#: MPC4261K) Made to Order

This product is a made-to-order Human MGST1 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • MGST1
  • Protein Length
  • Full length
  • Protein Class
  • Transferase
  • TMD
  • 4
  • Sequence
  • MVDLTQVMDDEVFMAFASYATIILSKMMLMSTATAFYRLTRKVFANPEDC
    VAFGKGENAKKYLRTDDRVERVRRAHLNDLENIIPFLGIGLLYSLSGPDP
    STAILHFRLFVGARIYHTIAYLTPLPQPNRALSFFVGYGVTLSMAYRLLK
    SKLYL

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • MGST1
  • Full Name
  • Microsomal glutathione S-transferase 1
  • Introduction
  • The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family consists of six human proteins, two of which are involved in the production of leukotrienes and prostaglandin E, important mediators of inflammation. Other family members, demonstrating glutathione S-transferase and peroxidase activities, are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. This gene encodes a protein that catalyzes the conjugation of glutathione to electrophiles and the reduction of lipid hydroperoxides. This protein is localized to the endoplasmic reticulum and outer mitochondrial membrane where it is thought to protect these membranes from oxidative stress. Several transcript variants, some non-protein coding and some protein coding, have been found for this gene.
  • Alternative Names
  • MGST1; MGST; GST12; MGST-I; glutathione S-transferase 12; microsomal GST-1; microsomal GST-I; Microsomal glutathione S-transferase 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us