Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human MMP14 (Matrix metallopeptidase 14) Expressed in E.coli for Antibody Discovery, Partial (21-284aa) (CAT#: MPX0311K)

This product is a 31 kDa Human MMP14 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • MMP14
  • Protein Length
  • Partial (21-284aa)
  • Protein Class
  • Protease
  • Molecular Weight
  • 31 kDa
  • TMD
  • 1
  • Sequence
  • ALASLGSAQSSSFSPEAWLQQYGYLPPGDL
    RTHTQRSPQSLSAAIAAMQKFYGLQVTGKADADTMKAMRRPRCGVPDKFG
    AEIKANVRRKRYAIQGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRV
    WESATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLA
    HAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHELGHALGLEHS
    SDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYG

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 10xHis tag at the C-terminus
  • Protein Format
  • Soluble
  • Endotoxin
  • <1.0 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE under reducing conditions and visualized by silver stain.
  • Buffer
  • Supplied as a 0.2 μm filtered solution in Tris, NaCl, CaCl2 and Glycerol.

Target

  • Target Protein
  • MMP14
  • Full Name
  • Matrix metallopeptidase 14
  • Introduction
  • Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. However, the protein encoded by this gene is a member of the membrane-type MMP (MT-MMP) subfamily; each member of this subfamily contains a potential transmembrane domain suggesting that these proteins are expressed at the cell surface rather than secreted. This protein activates MMP2 protein, and this activity may be involved in tumor invasion.
  • Alternative Names
  • MMP14; MMP-14; MMP-X1; MT-MMP; MT1MMP; MTMMP1; WNCHRS; MT1-MMP; MT-MMP 1; matrix metalloproteinase-14; matrix metallopeptidase 14 (membrane-inserted); membrane type 1 metalloprotease; membrane-type-1 matrix metalloproteinase; Matrix metallopeptidase 14

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us