Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human MPV17 (Mitochondrial inner membrane protein MPV17) Full Length (CAT#: MPC2878K) Made to Order

This product is a made-to-order Human MPV17 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • MPV17
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • TMD
  • 4
  • Sequence
  • MALWRAYQRALAAHPWKVQVLTAGSLMGLGDIISQQLVERRGLQEHQRGR
    TLTMVSLGCGFVGPVVGGWYKVLDRFIPGTTKVDALKKMLLDQGGFAPCF
    LGCFLPLVGALNGLSAQDNWAKLQRDYPDALITNYYLWPAVQLANFYLVP
    LHYRLAVVQCVAVIWNSYLSWKAHRL

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • MPV17
  • Full Name
  • Mitochondrial inner membrane protein MPV17
  • Introduction
  • This gene encodes a mitochondrial inner membrane protein that is implicated in the metabolism of reactive oxygen species. Mutations in this gene have been associated with the hepatocerebral form of mitochondrial DNA depletion syndrome (MDDS).
  • Alternative Names
  • MPV17; SYM1; CMT2EE; MTDPS6; protein Mpv17; MPV17, mitochondrial inner membrane protein; MpV17 mitochondrial inner membrane protein; Mpv17, human homolog of glomerulosclerosis and nephrotic syndrome; Mitochondrial inner membrane protein MPV17

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us