Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human NCR3LG1 (Natural killer cell cytotoxicity receptor 3 ligand 1) Expressed in NS0 for Antibody Discovery, Partial (1-262aa) (CAT#: MPX0838K)

This product is a 53.3 kDa Human NCR3LG1 membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • NCR3LG1
  • Protein Length
  • Partial (1-262aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 53.3 kDa
  • TMD
  • 1
  • Sequence
  • MTWRAAASTCAALLILLWALTTEGDLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITS
    MGITWFWKSLTFDKEVKVFEFFGDHQEAFRPGAIVSPWRLKSGDASLRLPGIQLEEAGEY
    RCEVVVTPLKAQGTVQLEVVASPASRLLLDQVGMKENEDKYMCESSGFYPEAINITWEKQ
    TQKFPHPIEISEDVITGPTIKNMDGTFNVTSCLKLNSSQEDPGTVYQCVVRHASLHTPLR
    SNFTLTAARHSLSETEKTDNFS

Product Description

  • Activity
  • Yes
  • Expression Systems
  • NS0
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE under reducing conditions and visualized by silver stain.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • NCR3LG1
  • Full Name
  • Natural killer cell cytotoxicity receptor 3 ligand 1
  • Introduction
  • B7H6 belongs to the B7 family (see MIM 605402) and is selectively expressed on tumor cells. Interaction of B7H6 with NKp30 (NCR3; MIM 611550) results in natural killer (NK) cell activation and cytotoxicity.
  • Alternative Names
  • NCR3LG1; B7H6; B7-H6; DKFZp686O24166; natural cytotoxicity triggering receptor 3 ligand 1; B7 homolog 6; putative Ig-like domain-containing protein DKFZp686O24166/DKFZp686I21167; Natural killer cell cytotoxicity receptor 3 ligand 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us