Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human NDUFA3 (NADH:ubiquinone oxidoreductase subunit A3) Expressed in E.coli with GST tag at the N-terminus for Antibody Discovery, Partial (2-84aa) (CAT#: MPX4476K)

This product is a 36.1kDa Human NDUFA3 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • NDUFA3
  • Protein Length
  • Partial (2-84aa)
  • Protein Class
  • Transporter
  • Molecular Weight
  • 36.1kDa
  • TMD
  • 1
  • Sequence
  • AARVGAFLKNAWDKEPVLVVSFVVGGLAVILPPLSPYFKYSVMINKATPYNYPVPVRDDGNMPDVPSHPQDPQGPSLEWLKKL

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • GST tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • NDUFA3
  • Full Name
  • NADH:ubiquinone oxidoreductase subunit A3
  • Alternative Names
  • NDUFA3; B9; CI-B9; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 3, 9kDa; NADH-ubiquinone oxidoreductase B9 subunit; complex I B9 subunit; complex I-B9; NADH:ubiquinone oxidoreductase subunit A3

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us