Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human NUP210 (Nucleoporin 210) Expressed in E.coli with 6xHis tag at the N-terminus for Antibody Discovery, Partial (1529-1808aa) (CAT#: MPX4464K)

This product is a 34.5kDa Human NUP210 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • NUP210
  • Protein Length
  • Partial (1529-1808aa)
  • Protein Class
  • Transporter
  • Molecular Weight
  • 34.5kDa
  • TMD
  • 1
  • Sequence
  • AVGSVTVYYEVAGHLRTYKEVVVSVPQRIMARHLHPIQTSFQEATASKVIVAVGDRSSNLRGECTPTQREVIQALHPETLISCQSQFKPAVFDFPSQDVFTVEPQFDTALGQYFCSITMHRLTDKQRKHLSMKKTALVVSASLSSSHFSTEQVGAEVPFSPGLFADQAEILLSNHYTSSEIRVFGAPEVLENLEVKSGSPAVLAFAKEKSFGWPSFITYTVGVLDPAAGSQGPLSTTLTFSSPVTNQAIAIPVTVAFVVDRRGPGPYGASLFQHFLDSYQ

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • NUP210
  • Full Name
  • Nucleoporin 210
  • Introduction
  • The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. The protein encoded by this gene is a membrane-spanning glycoprotein that is a major component of the nuclear pore complex. Multiple pseudogenes related to this gene are located on chromosome 3.
  • Alternative Names
  • NUP210; GP210; POM210; nuclear pore membrane glycoprotein 210; nuclear envelope pore membrane protein POM 210; nuclear pore protein gp210; nucleoporin 210kDa; nucleoporin Nup210; pore membrane protein of 210 kDa; Nucleoporin 210

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us