Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human PRPH2 (Peripherin 2) Full Length (CAT#: MPC1458K) Made to Order

This product is a 39.1 kDa Human PRPH2 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • PRPH2
  • Protein Length
  • Full length
  • Protein Class
  • Cell adhesion
  • Molecular Weight
  • 39.1 kDa
  • TMD
  • 4
  • Sequence
  • MALLKVKFDQKKRVKLAQGLWLMNWFSVLAGIIIFSLGLFLKIELRKRSD
    VMNNSESHFVPNSLIGMGVLSCVFNSLAGKICYDALDPAKYARWKPWLKP
    YLAICVLFNIILFLVALCCFLLRGSLENTLGQGLKNGMKYYRDTDTPGRC
    FMKKTIDMLQIEFKCCGNNGFRDWFEIQWISNRYLDFSSKEVKDRIKSNV
    DGRYLVDGVPFSCCNPSSPRPCIQYQITNNSAHYSYDHQTEELNLWVRGC
    RAALLSYYSSLMNSMGVVTLLIWLFEVTITIGLRYLQTSLDGVSNPEESE
    SESEGWLLEKSVPETWKAFLESVKKLGKGNQVEAEGAGAGQAPEAG

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • PRPH2
  • Full Name
  • Peripherin 2
  • Introduction
  • The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein found in the outer segment of both rod and cone photoreceptor cells. It may function as an adhesion molecule involved in stabilization and compaction of outer segment disks or in the maintenance of the curvature of the rim. This protein is essential for disk morphogenesis. Defects in this gene are associated with both central and peripheral retinal degenerations. Some of the various phenotypically different disorders are autosomal dominant retinitis pigmentosa, progressive macular degeneration, macular dystrophy and retinitis pigmentosa digenic.
  • Alternative Names
  • PRPH2; DS; RDS; RP7; rd2; AVMD; PRPH; AOFMD; CACD2; MDBS1; TSPAN22; peripherin-2; peripherin 2 (retinal degeneration, slow); peripherin 2, homolog of mouse; peripherin, photoreceptor type; retinal degeneration slow protein; retinal peripherin; tetraspanin-22; tspan-22; Peripherin 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us