Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human SECTM1 (Secreted and transmembrane 1) Expressed in CHO for Antibody Discovery, Partial (29-145aa) (CAT#: MPX0140K)

This product is a 39.3 kDa Human SECTM1 membrane protein expressed in CHO. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SECTM1
  • Protein Length
  • Partial (29-145aa)
  • Protein Class
  • Transporter
  • Molecular Weight
  • 39.3 kDa
  • TMD
  • 1
  • Sequence
  • QNEGWDSPICTEGVVSVSWGEN
    TVMSCNISNAFSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQLQVQGGVA
    QLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTG

Product Description

  • Expression Systems
  • CHO
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in PBS.
  • Endotoxin
  • <1.0 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE under reducing conditions and visualized by silver stain
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • SECTM1
  • Full Name
  • Secreted and transmembrane 1
  • Introduction
  • This gene encodes a transmembrane and secreted protein with characteristics of a type 1a transmembrane protein. It is found in a perinuclear Golgi-like pattern and thought to be involved in hematopoietic and/or immune system processes.
  • Alternative Names
  • SECTM1; K12; SECTM; secreted and transmembrane protein 1; type 1a transmembrane protein; Secreted and transmembrane 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us