Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human TACSTD2 (Tumor associated calcium signal transducer 2, 27-274aa) for Antibody Discovery (CAT#: MP1501J)

This product is a 56.8 kDa Human TACSTD2 membrane protein expressed in Mammalian cell. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TACSTD2
  • Protein Length
  • Partial (27-274aa)
  • Protein Class
  • Immune Checkpoints
  • Molecular Weight
  • 56.8 kDa
  • TMD
  • 1
  • Sequence
  • HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT

Product Description

  • Activity
  • Yes
  • Expression Systems
  • Mammalian cell
  • Tag
  • C-hFc
  • Reconstitution
  • Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration).
  • Endotoxin
  • <1.0 EU/μg
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Target

  • Target Protein
  • TACSTD2
  • Full Name
  • Tumor associated calcium signal transducer 2
  • Introduction
  • May function as a growth factor receptor.
  • Alternative Names
  • EGP1; GP50; M1S1; EGP-1; TROP2; GA7331; GA733-1; Cell surface glycoprotein Trop 2; Cell surface glycoprotein Trop-2; Cell surface glycoprotein Trop2; Epithelial glycoprotein 1; GA733 1; GA7331; M1S 1; M1S1; Membrane component chromosome 1 surface marker 1; Pancreatic carcinoma marker protein GA733 1; Pancreatic carcinoma marker protein GA733-1; Pancreatic carcinoma marker protein GA7331; TACD 2; TACD2_HUMAN; TACSTD 2; Tacstd2; Trop 2; Trop2; Tumor associated calcium signal transducer 2 precursor; Tumor-associated calcium signal transducer 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us