Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Mouse Elovl7 (ELOVL family member 7, elongation of long chain fatty acids (yeast)) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX2911K)

This product is a Mouse Elovl7 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Mouse
  • Target Protein
  • Elovl7
  • Protein Length
  • Full Length
  • Protein Class
  • Transferase
  • TMD
  • 7
  • Sequence
  • MAFSDLTSRTVRFYDNWIKDADPRVEDYLLMSSPLPQTIILGLYVYFVTSLGPKLMENRKPFELKKAMITYNFFIVLFSVYMCYEFVMSGWGTGYSFRCDIVDYSQSPRAMRMVHTCWLYYFSKFIELLDTIFFVLRKKNSQVTFLHVFHHTIMPWTWWFGVKFAAGGLGTFHAFLNTAVHVVMYSYYGLCAMGPAYQKYLWWKKHLTSLQLVQFVLVTIHIGQIFFMEDCNYQYPVFLYIIMSYGCIFLLLFLHFWYRAYTKGQRLPKTLENGNCKSKRH

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • Elovl7
  • Full Name
  • ELOVL family member 7, elongation of long chain fatty acids (yeast)
  • Alternative Names
  • Elovl7; AI840082; 9130013K24Rik; elongation of very long chain fatty acids protein 7; 3-keto acyl-CoA synthase Elovl7; ELOVL FA elongase 7; ELOVL fatty acid elongase 7; elongation of very long chain fatty acids-like 7; very long chain 3-ketoacyl-CoA synthase 7; very long chain 3-oxoacyl-CoA synthase 7; ELOVL family member 7, elongation of long chain fatty acids (yeast)

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us