Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Mouse Tyrobp (TYRO protein tyrosine kinase binding protein) Expressed in vitro E.coli expression system, Full Length of Mature Protein (CAT#: MPX3676K)

This product is a Mouse Tyrobp membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Mouse
  • Target Protein
  • Tyrobp
  • Protein Length
  • Full Length of Mature Protein
  • Protein Class
  • Immunity
  • TMD
  • 1
  • Sequence
  • LSPVQAQSDTFPRCDCSSVSPGVLAGIVLGDLVLTLLIALAVYSLGRLVSRGQGTAEGTRKQHIAETESPYQELQGQRPEVYSDLNTQRQYYR

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • Tyrobp
  • Full Name
  • TYRO protein tyrosine kinase binding protein
  • Alternative Names
  • Tyrobp; K; DAP; Ly83; DAP12; KARAP; TYRO protein tyrosine kinase-binding protein; DNAX-activation protein 12; KAR-associated protein; killer cell activating receptor associated protein; killer-activating receptor-associated protein; TYRO protein tyrosine kinase binding protein

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us