Solute Family 1, member 7 (SLC1A7) is a protein encoded by the SLC1A7 gene in humans. It is also known as excitatory amino acid transporter 5 (EAAT5) or the retinal glutamate transporter. SLC1A7 is mainly expressed on the retina and has a high affinity for the excitatory amino acid glutamic acid. When stimulated by this amino acid, SLC1A7 produces chloride ions. SLC1A7 is expressed in photoreceptors, bipolar disorder and amac secreting cells.
| Basic Information of SLC1A7 | |
| Protein Name | Excitatory amino acid transporter 5 (EAAT5) |
| Gene Name | SLC1A7 |
| Aliases | Retinal glutamate transporter, Solute carrier family 1 member 7 |
| Organism | Homo sapiens (Human) |
| UniProt ID | O00341 |
| Transmembrane Times | 10 |
| Length (aa) | 560 |
| Sequence | MVPHAILARGRDVCRRNGLLILSVLSVIVGCLLGFFLRTRRLSPQEISYFQFPGELLMRMLKMMILPLVVSSLMSGLASLDAKTSSRLGVLTVAYYLWTTFMAVIVGIFMVSIIHPGSAAQKETTEQSGKPIMSSADALLDLIRNMFPANLVEATFKQYRTKTTPVVKSPKVAPEEAPPRRILIYGVQEENGSHVQNFALDLTPPPEVVYKSEPGTSDGMNVLGIVFFSATMGIMLGRMGDSGAPLVSFCQCLNESVMKIVAVAVWYFPFGIVFLIAGKILEMDDPRAVGKKLGFYSVTVVCGLVLHGLFILPLLYFFITKKNPIVFIRGILQALLIALATSSSSATLPITFKCLLENNHIDRRIARFVLPVGATINMDGTALYEAVAAIFIAQVNNYELDFGQIITISITATAASIGAAGIPQAGLVTMVIVLTSVGLPTDDITLIIAVDWALDRFRTMINVLGDALAAGIMAHICRKDFARDTGTEKLLPCETKPVSLQEIVAAQQNGCVKSVAEASELTLGPTCPHHVPVQVEQDEELPAASLNHCTIQISELETNV |
In the mammalian central nervous system, five subtypes were identified and named EAAT1 to EAAT5. It has been found that EAATs can regulate the currents induced by the sublayers beyond the prediction of stoichiometry, which is comparable in size to true ion channels. SLC1A7 has been shown to be a post-synaptic receptor and regulates the photoreaction of distant bipolar cells through its associated chloride conductance. SLC1A7 was cloned by Arizza et al., which is the least studied in all regions, probably due to a broad view that it is a retinal-specific glutamate transporter and therefore glutamate homeostasis with other tissues. Nothing.
Fig.1 The structure of SLC1A7 Protein.
The immunohistochemical data suggest that the presence of postsynaptic SLC1A7 on some DBCRs and some dbcc provides an anatomical basis for the role of SLC1A7 in DBC photoreactions.
These data clarify the unique functional properties of SLC1A7, a low-affinity and low-capacity glutamate transport system that optimizes negative ion channels for anion conduction over a negative voltage range.
This article offers an example of EAATs in presynaptic elements, implying the presence of transporters in hair cells.
These results suggest that SLC1A7 may not resemble a typical high-capacity glutamate transporter on the retina; instead, it may be a slow glutamate receptor and/or glutamate buffer system.
It is concluded that SLC1A7 is a widely distributed protein. Whether it acts as a glutamate transporter in all positions remains to be determined.
To obtain the soluble and functional target protein, the versatile MemDX™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-SLC1A7 antibody development services.
Creative Biolabs' skillful scientists are glad to leverage our expertise and advanced technologies to help you with the member protein research. If you are interested, please feel free to contact us for more details.
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.