Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsWith over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications. Highlights
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
HighlightsWith deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
HighlightsGet a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
HighlightsCalcium-binding mitochondrial carrier protein Aralar2, also known as solute carrier family 25, member 13 (SLC25A13), is a transmembrane protein encoded by the SLC25A13 gene in humans. This protein is called Citrin in common. The human gene SLC25A13 is localized at chromosome 7q21.3, which consists of 18 exons and encodes a 3.4kb transcript with a predicted opening reading frame (ORF) of 2,025 bp. Citrin is involved in type II citrullinemia. And the deficiency of Citrin results in neonatal intrahepatic cholestasis. When it comes to vitamin P, citrin is the most active bioflavonoid in lemons, which was found to be Eriodictyol (but a more active ingredient was discovered there decades later).
| Basic Information of SLC25A13 | |
| Protein Name | Calcium-binding mitochondrial carrier protein Aralar2 |
| Gene Name | SLC25A13 |
| Aliases | Citrin, Mitochondrial aspartate glutamate carrier 2, Solute carrier family 25 member 13 |
| Organism | Homo sapiens (Human) |
| UniProt ID | Q9UJS0 |
| Transmembrane Times | 6 |
| Length (aa) | 675 |
| Sequence | MAAAKVALTKRADPAELRTIFLKYASIEKNGEFFMSPNDFVTRYLNIFGESQPNPKTVELLSGVVDQTKDGLISFQEFVAFESVLCAPDALFMVAFQLFDKAGKGEVTFEDVKQVFGQTTIHQHIPFNWDSEFVQLHFGKERKRHLTYAEFTQFLLEIQLEHAKQAFVQRDNARTGRVTAIDFRDIMVTIRPHVLTPFVEECLVAAAGGTTSHQVSFSYFNGFNSLLNNMELIRKIYSTLAGTRKDVEVTKEEFVLAAQKFGQVTPMEVDILFQLADLYEPRGRMTLADIERIAPLEEGTLPFNLAEAQRQKASGDSARPVLLQVAESAYRFGLGSVAGAVGATAVYPIDLVKTRMQNQRSTGSFVGELMYKNSFDCFKKVLRYEGFFGLYRGLLPQLLGVAPEKAIKLTVNDFVRDKFMHKDGSVPLAAEILAGGCAGGSQVIFTNPLEIVKIRLQVAGEITTGPRVSALSVVRDLGFFGIYKGAKACFLRDIPFSAIYFPCYAHVKASFANEDGQVSPGSLLLAGAIAGMPAASLVTPADVIKTRLQVAARAGQTTYSGVIDCFRKILREEGPKALWKGAGARVFRSSPQFGVTLLTYELLQRWFYIDFGGVKPMGSEPVPKSRINLPAPNPDHVGGYKLAVATFAGIENKFGLYLPLFKPSVSTSKAIGGGP |
SLC25A13 mutations result in citrin deficiency (CD), and CTLN2 was the firstly-described CD phenotype, which occurs in adolescents or adults and the prognosis is usually not benign. The protein product of this gene is designated as citrin, which, as the liver-type aspartate/glutamate carrier isoform 2 (AGC2), functions to export aspartate from the mitochondrial matrix in exchange for cytosolic glutamate and H+, playing important roles in the urea cycle and malate-aspartate shuttle. Biallelic SLC25A13 mutations result in citrin deficiency (CD), a disease entity with three age-dependent clinical phenotypes.
Fig.1 The structure of Calcium-binding mitochondrial carrier protein Aralar2.
Analysis of the SLC25A13 gene and its protein/messenger RNA products remains a reliable tool for the diagnosis of patients with celiac disease. To date, the SLC25A13 variant profile of Chinese patients with celiac disease has not been well described.
This article reveals that the hitherto largest deletion in SLC25A13 mutation spectrum is the novel gross deletion, which silenced the transcriptional and translational expression of the affected SLC25A13 allele.
These findings enriched the mutant spectrum of SLC25A13, brought new insights into the geographical distribution of mutations and genotypes, and provided a reliable basis for NICCD to identify and identify relevant molecular targets in different regions of China.
This study suggests that SLC25A13 gene mutations distribution is associated with the GCT level.
This research shows that the entire ORF of the SLC25A13 cDNA can be successfully amplified by culturing human amniocytes, and exon 5-11 are used as a new SLC25A13 transcript.
To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-KCNAB2 antibody development services.
Creative Biolabs' skillful scientists are glad to leverage our expertise and advanced technologies to help you with the member protein research. If you are interested, please feel free to contact us for more details.
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.
