DRD2 Membrane Protein Introduction

Introduction of DRD2

DRD2 is encoded by the DRD2 gene. As members of the heptahelical G protein-coupled receptor superfamily, D2 receptors activate the αi subunits and then lead to inhibition of cyclic adenosine monophosphate (cAMP) synthesis. DRD2 is present mainly in the striatum of the central nervous system. DRD2 possess seven transmembrane alpha helices and uses dopamine as the preferred endogenous agonist. Meanwhile, its structure reveals a ligand binding pocket distinct from that of other structurally determined GPCRs.

Basic Information of DRD2
Protein Name	D(2) dopamine receptor
Gene Name	DRD2
Aliases	D2R, D2DR
Organism	Homo sapiens (Human)
UniProt ID	P14416
Transmembrane Times	7
Length (aa)	443
Sequence	MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVS REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQN ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPL KGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPP SHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSR RKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSA VNPIIYTTFNIEFRKAFLKILHC

Function of DRD2 Membrane Protein

A number of studies show that D2 receptor signaling alters glutamate receptor function in dorsal striatal MSNs. The neuromodulator dopamine signals through the dopamine D2 receptor (D2R) to modulate central nervous system functions through diverse signal transduction pathways. D2R is a prominent target for drug treatments in disorders where dopamine function is aberrant, such as schizophrenia. D2R signals through distinct G-protein and β-arrestin pathways and drugs that are functionally selective for these pathways could have improved therapeutic potential. It has been extensively studied during the past few decades because it offers numerous possibilities for therapeutic applications.

DRD2 Membrane Protein Introduction

Application of DRD2 Membrane Protein in Literature

Gagnon, D., et al. Striatal neurons expressing D 1 and D 2 receptors are morphologically distinct and differently affected by dopamine denervation in mice. Scientific reports. 2017, 7: 41432. PubMed ID: 28128287

This article indicates that D1/D2 MSNs (medium spiny neurons) in the mouse striatum form a distinct neuronal population that is affected differently by dopamine deafferentation that characterizes Parkinson's disease.
Rocchetti, J., et al. Presynaptic D2 dopamine receptors control long-term depression expression and memory processes in the temporal hippocampus. Biological psychiatry. 2015, 77(6): 513-525. PubMed ID: 24742619

This article reveals that presynaptic D2Rs in dopamine fibers of the temporal hippocampus tightly modulate long-term depression expression and play a major role in the regulation of hippocampal learning and memory.
Peterson, S., et al. Elucidation of G-protein and β-arrestin functional selectivity at the dopamine D2 receptor. Proceedings of the National Academy of Sciences. 2015, 112(22): 7097-7102. PubMed ID: 25964346

This article reveals the mutant receptors generated provide a molecular tool set that should enable a better definition of the individual roles of G-protein and β-arrestin signaling pathways in D2R pharmacology, neurobiology, and associated pathologies.

DRD2 Preparation Options

To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-DRD2 antibody development services.

As a forward-looking research institute as well as a leading customer service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

	USA: Europe: Germany:
	Call us at: USA: UK: Germany:
	Fax:
	Email: