Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human COA3 (Cytochrome c oxidase assembly factor 3) Full Length (CAT#: MPC1624K) Made to Order

This product is a 11.7 kDa Human COA3 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • COA3
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 11.7 kDa
  • TMD
  • 1
  • Sequence
  • MASSGAGDPLDSKRGEAPFAQRIDPTREKLTPEQLHSMRQAELAQWQKVL
    PRRRTRNIVTGLGIGALVLAIYGYTFYSISQERFLDELEDEAKAARARAL
    ARASGS

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • COA3
  • Full Name
  • Cytochrome c oxidase assembly factor 3
  • Introduction
  • This gene encodes a member of the cytochrome c oxidase assembly factor family. Studies of a related gene in fly suggest that the encoded protein is localized to mitochondria and is essential for cytochrome c oxidase function.
  • Alternative Names
  • COA3; COX25; CCDC56; HSPC009; MC4DN14; MITRAC12; cytochrome c oxidase assembly factor 3 homolog, mitochondrial; coiled-coil domain-containing protein 56; cytochrome C oxidase assembly factor 3 homolog, mitochondrial; cytochrome c oxidase assembly protein 3 homolog, mitochondrial; mitochondrial translation regulation assembly intermediate of cytochrome c oxidase protein of 12 kDa; Cytochrome c oxidase assembly factor 3

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us