Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human PRRG2 (Proline rich and Gla domain 2) Full Length (CAT#: MPC1880K) Made to Order

This product is a 22.3 kDa Human PRRG2 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • PRRG2
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 22.3 kDa
  • TMD
  • 1
  • Sequence
  • MRGHPSLLLLYMALTTCLDTSPSEETDQEVFLGPPEAQSFLSSHTRIPRA
    NHWDLELLTPGNLERECLEERCSWEEAREYFEDNTLTERFWESYIYNGKG
    GRGRVDVASLAVGLTGGILLIVLAGLGAFWYLRWRQHRGQQPCPQEAGLI
    SPLSPLNPLGPPTPLPPPPPPPPGLPTYEQALAASGVHDAPPPPYTSLRR
    PH

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • PRRG2
  • Full Name
  • Proline rich and Gla domain 2
  • Introduction
  • The protein encoded by this gene is a single-pass transmembrane protein containing an N-terminal gamma-carboxyglutamic acid (Gla) domain and tandem Pro/Leu-Pro-Xaa-Tyr (PY) motifs at its C-terminal end. The Gla domain is exposed on the cell surface while the PY motifs are cytoplasmic. The PY motifs of the encoded protein have been shown to interact with YAP1, a WW domain-containing protein. Therefore, it is thought that the encoded protein may be part of a signal transduction pathway. Two transcript variants encoding different isoforms have been found for this gene.
  • Alternative Names
  • PRRG2; PRGP2; transmembrane gamma-carboxyglutamic acid protein 2; proline rich Gla (G-carboxyglutamic acid) 2; proline-rich Gla (G-carboxglutamic acid) polypeptide 2; proline-rich Gla (G-carboxyglutamic acid) polypeptide 2; proline-rich Gla protein 2; proline-rich gamma-carboxyglutamic acid protein 2; Proline rich and Gla domain 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us