Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human SLC52A2 (Solute carrier family 52 member 2) Full Length (CAT#: MPC0878K) Made to Order

This product is a 45.7 kDa Human SLC52A2 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SLC52A2
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 45.7 kDa
  • TMD
  • 11
  • Sequence
  • MAAPTPARPVLTHLLVALFGMGSWAAVNGIWVELPVVVKELPEGWSLPSY
    VSVLVALGNLGLLVVTLWRRLAPGKDEQVPIRVVQVLGMVGTALLASLWH
    HVAPVAGQLHSVAFLALAFVLALACCASNVTFLPFLSHLPPRFLRSFFLG
    QGLSALLPCVLALVQGVGRLECPPAPINGTPGPPLDFLERFPASTFFWAL
    TALLVASAAAFQGLLLLLPPPPSVPTGELGSGLQVGAPGAEEEVEESSPL
    QEPPSQAAGTTPGPDPKAYQLLSARSACLLGLLAATNALTNGVLPAVQSF
    SCLPYGRLAYHLAVVLGSAANPLACFLAMGVLCRSLAGLGGLSLLGVFCG
    GYLMALAVLSPCPPLVGTSAGVVLVVLSWVLCLGVFSYVKVAASSLLHGG
    GRPALLAAGVAIQVGSLLGAVAMFPPTSIYHVFHSRKDCADPCDS

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • SLC52A2
  • Full Name
  • Solute carrier family 52 member 2
  • Introduction
  • This gene encodes a membrane protein which belongs to the riboflavin transporter family. In humans, riboflavin must be obtained by intestinal absorption because it cannot be synthesized by the body. The water-soluble vitamin riboflavin is processed to the coenzymes flavin mononucleotide (FMN) and flavin adenine dinucleotide (FAD) which then act as intermediaries in many cellular metabolic reactions. Paralogous members of the riboflavin transporter gene family are located on chromosomes 17 and 20. Unlike other members of this family, this gene has higher expression in brain tissue than small intestine. Alternative splicing of this gene results in multiple transcript variants encoding the same protein. Mutations in this gene have been associated with Brown-Vialetto-Van Laere syndrome 2 - an autosomal recessive progressive neurologic disorder characterized by deafness, bulbar dysfunction, and axial and limb hypotonia.
  • Alternative Names
  • PAR1; RFT3; RFVT2; hRFT3; BVVLS2; GPCR41; GPR172A; D15Ertd747e; solute carrier family 52, riboflavin transporter, member 2; G protein-coupled receptor 172A; PERV-A receptor 1; porcine endogenous retrovirus A receptor 1; putative G-protein coupled receptor GPCR41; riboflavin transporter 3; solute carrier family 52 (riboflavin transporter), member 2; SLC52A2; Solute carrier family 52 member 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us