Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human TM4SF20 (Transmembrane 4 L six family member 20) Full Length (CAT#: MPC1182K) Made to Order

This product is a 25 kDa Human TM4SF20 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TM4SF20
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 25 kDa
  • TMD
  • 4
  • Sequence
  • MTCCEGWTSCNGFSLLVLLLLGVVLNAIPLIVSLVEEDQFSQNPISCFEW
    WFPGIIGAGLMAIPATTMSLTARKRACCNNRTGMFLSSLFSVITVIGALY
    CMLISIQALLKGPLMCNSPSNSNANCEFSLKNISDIHPESFNLQWFFNDS
    CAPPTGFNKPTSNDTMASGWRASSFHFDSEENKHRLIHFSVFLGLLLVGI
    LEVLFGLSQIVIGFLGCLCGVSKRRSQIV

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • TM4SF20
  • Full Name
  • Transmembrane 4 L six family member 20
  • Introduction
  • The protein encoded by this gene is a member of the four-transmembrane L6 superfamily. Members of this family function in various cellular processes including cell proliferation, motility, and adhesion via their interactions with integrins. In human brain tissue, this gene is expressed at high levels in the parietal lobe, occipital lobe, hippocampus, pons, white matter, corpus callosum, and cerebellum. Knockout of the homologous gene in mouse results in a neurobehavioral phenotype with suggested enhanced motor coordination. A deletion mutation in the human gene is associated with specific language impairment-5.
  • Alternative Names
  • TM4SF20; SLI5; PRO994; TCCE518; transmembrane 4 L6 family member 20; UNQ518/PRO994; Transmembrane 4 L six family member 20

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us