Close

NPY1R Membrane Protein Introduction

Introduction of NPY1R

Neuropeptide Y receptor 1 is a protein that in humans is encoded by the NPY1R gene, and is the member of the Neuropeptide Y receptor family. It also belongs to the G-protein-coupled receptor superfamily. NPY receptor family comprises four functional NPY receptor subtypes (Y1R, Y2R, Y4R Y5R), which are widely distributed in the central and peripheral nervous system and involved in the regulation of numerous physiological functions. The NPY1R has been suggested as a target for cancer diagnosis because of its overexpression in a variety of tumors.

Basic Information of NPY1R
Protein Name Neuropeptide Y receptor type 1
Gene Name NPY1R
Aliases NPYR, NPYY1
Organism Homo sapiens (Human)
UniProt ID P25929
Transmembrane Times 7
Length (aa) 384
Sequence MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI

Function of NPY1R Membrane Protein

Neuropeptide Y (NPY) is a widely distributed peptide in the central and peripheral nervous system and involved in the regulation of numerous physiological functions. The physiological functions of this neurohormone are mediated by a family of five receptors which belong to the class A of the GPCRs and which are expressed in neuronal and non-neuronal tissues. Recent studies have shown that activation of the NPY receptors leads to cell proliferation, neurogenesis or gene transcription. For example, NPY1R is highly expressed in β-cells, indicating the potential for an inhibitory effect of NPY1R signaling to directly regulate insulin release from β-cells. Due to the overexpression in a variety of tumors, NPY1R has also been suggested as a target for cancer diagnosis.

Structure of NPY1-R membrane protein. Fig.1 Structure of NPY1-R membrane protein.

Application of NPY1R Membrane Protein in Literature

  1. Lv X., et al. Neuropeptide Y1 receptor inhibits cell growth through inactivating mitogen-activated protein kinase signal pathway in human hepatocellular carcinoma. Medical oncology. 2016, 33(7): 70. PubMed ID: 27262566.

    Authors of this group analyzed the expression of NPY receptors by real-time polymerase chain reaction, they found that mRNA and protein level of NPY1R significantly decreased in Hepatocellular carcinoma (HCC) tissues. And they considered that NPY1R plays an inhibitory role in tumor growth and may be a promising therapeutic target for HCC.

  2. Lecat S., et al. Neuropeptide Y receptor mediates activation of ERK1/2 via transactivation of the IGF receptor. Cellular Signaling. 2015, 27(7): 1297-304. PubMed ID: 25817573.

    The article found that the NPY agonist elicits a transient phosphorylation of the extracellular signal-regulated kinases (ERK1/2). Their analysis is the first to show that transactivation of the IGFR receptor is required.

  3. Li L., et al. Altered expression of neuropeptide Y receptors caused by focal cortical dysplasia in human intractable epilepsy. Oncotarget. 2016, 7(13): 15329-38. PubMed ID: 26943580.

    This article found that NPY1R and NPY2R were upregulated at the mRNA and protein levels in the temporal and frontal lobes in FCD lesions results. They demonstrated the altered expression of NPY1R, NPY2R, and NPY5R occurs in FCD lesions within the temporal, frontal and parietal lobe.

  4. Loh K., et al. Inhibition of Y1 receptor signaling improves islet transplant outcome. Nature communications. 2017, 8(1): 490. PubMed ID: 28887564

    The authors demonstrated that NPY1R signaling inhibits insulin release in β-cells, and showed that this can be pharmacologically exploited to boost insulin secretion.

NPY1R Preparation Options

To obtain the soluble and functional target protein, the versatile MemDX™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-NPY1R antibody development services.


As a forward-looking research institute as well as a leading custom service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.


All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us