Introduction of NPY1R
Neuropeptide Y receptor 1 is a protein that in humans is encoded by the NPY1R gene, and is the member of the Neuropeptide Y receptor family. It also belongs to the G-protein-coupled receptor superfamily. NPY receptor family comprises four functional NPY receptor subtypes (Y1R, Y2R, Y4R Y5R), which are widely distributed in the central and peripheral nervous system and involved in the regulation of numerous physiological functions. The NPY1R has been suggested as a target for cancer diagnosis because of its overexpression in a variety of tumors.
| Basic Information of NPY1R | |
| Protein Name | Neuropeptide Y receptor type 1 |
| Gene Name | NPY1R |
| Aliases | NPYR, NPYY1 |
| Organism | Homo sapiens (Human) |
| UniProt ID | P25929 |
| Transmembrane Times | 7 |
| Length (aa) | 384 |
| Sequence | MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI |
Function of NPY1R Membrane Protein
Neuropeptide Y (NPY) is a widely distributed peptide in the central and peripheral nervous system and involved in the regulation of numerous physiological functions. The physiological functions of this neurohormone are mediated by a family of five receptors which belong to the class A of the GPCRs and which are expressed in neuronal and non-neuronal tissues. Recent studies have shown that activation of the NPY receptors leads to cell proliferation, neurogenesis or gene transcription. For example, NPY1R is highly expressed in β-cells, indicating the potential for an inhibitory effect of NPY1R signaling to directly regulate insulin release from β-cells. Due to the overexpression in a variety of tumors, NPY1R has also been suggested as a target for cancer diagnosis.
Fig.1 Structure of NPY1-R membrane protein.
Application of NPY1R Membrane Protein in Literature
Authors of this group analyzed the expression of NPY receptors by real-time polymerase chain reaction, they found that mRNA and protein level of NPY1R significantly decreased in Hepatocellular carcinoma (HCC) tissues. And they considered that NPY1R plays an inhibitory role in tumor growth and may be a promising therapeutic target for HCC.
The article found that the NPY agonist elicits a transient phosphorylation of the extracellular signal-regulated kinases (ERK1/2). Their analysis is the first to show that transactivation of the IGFR receptor is required.
This article found that NPY1R and NPY2R were upregulated at the mRNA and protein levels in the temporal and frontal lobes in FCD lesions results. They demonstrated the altered expression of NPY1R, NPY2R, and NPY5R occurs in FCD lesions within the temporal, frontal and parietal lobe.
The authors demonstrated that NPY1R signaling inhibits insulin release in β-cells, and showed that this can be pharmacologically exploited to boost insulin secretion.
NPY1R Preparation Options
To obtain the soluble and functional target protein, the versatile MemDX™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-NPY1R antibody development services.
As a forward-looking research institute as well as a leading custom service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.