Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Recombinant Full Length Human CLDN6 Protein (Nanodisc, Rho1D4 Tag) (CAT#: SYF-0926-CW99)

Recombinant full-length human CLDN6 protein reconstituted in a nanodisc membrane-mimetic system for biochemical, binding, and assay development applications.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CLDN6
  • Protein Length
  • Full-length
  • Protein Class
  • Tight Junction Protein
  • Molecular Weight
  • 23 kDa
  • Sequence
  • MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV

Product Description

  • Expression Systems
  • HEK293 cells
  • Tag
  • The construct includes a C-terminal Rho1D4 tag.
  • Protein Format
  • Nanodisc
  • Purity
  • The protein purity is greater than 90% as determined by SDS-PAGE.

Target

  • Target Protein
  • CLDN6
  • Full Name
  • claudin 6
  • Introduction
  • Claudin-6 (CLDN6) is a full-length human claudin. Claudin 6 is a protein has been demonstrated to play a pivotal role in the specific obliteration of the intercellular space, a process that is integral to the maintenance of tight junctions. It functions as a receptor for the hepatitis C virus (HCV) to enter into hepatitic cells. Furthermore, it has been identified as a tumour-promoting gene, with a correlation between its expression and various forms of cancer, including ovarian, cervical, and endometrial carcinomas. The protein is supplied in an MSP-free, copolymer-stabilized native-lipid nanodisc. The preparation uses 2-step purification.

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us