Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Recombinant Full Length Human DRD2 Protein (Nanodisc, Rho1D4 Tag) (CAT#: SYF-0926-CW115)

Recombinant full-length human DRD2 protein reconstituted in a nanodisc membrane-mimetic system for biochemical, binding, and assay development applications.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • DRD2
  • Protein Length
  • Full-length
  • Protein Class
  • GPCR
  • Molecular Weight
  • 51 kDa
  • Sequence
  • MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHC

Product Description

  • Expression Systems
  • Trichoplusia ni insect cells
  • Tag
  • The construct includes a C-terminal Rho1D4 tag.
  • Protein Format
  • Nanodisc
  • Purity
  • The protein purity is greater than 90% as determined by SDS-PAGE.

Target

  • Target Protein
  • DRD2
  • Full Name
  • dopamine receptor D2
  • Introduction
  • D(2) dopamine receptor (DRD2) is a full-length human gpcr. D(2) dopamine receptoris a G-protein coupled receptor inhibits adenylyl cyclase activity and is involved in reward-mediating mesocorticolimbic pathways. DRD2 has been also associated with schizophrenia and moreover it is the main receptor for many antipsychotic drugs. The protein is supplied in an MSP-free, copolymer-stabilized native-lipid nanodisc. The preparation uses 2-step purification.
  • Alternative Names
  • D2R

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us