Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Recombinant Full Length Human TSPAN8 Protein (Nanodisc, Rho1D4 Tag) (CAT#: SYF-0926-CW208)

Recombinant full-length human TSPAN8 protein reconstituted in a nanodisc membrane-mimetic system for biochemical, binding, and assay development applications.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TSPAN8
  • Protein Length
  • Full-length
  • Protein Class
  • Tetraspanin
  • Molecular Weight
  • 27 kDa
  • Sequence
  • MAGVSACIKYSMFTFNFLFWLCGILILALAIWVRVSNDSQAIFGSEDVGSSSYVAVDILIAVGAIIMILGFLGCCGAIKESRCMLLLFFIGLLLILLLQVATGILGAVFKSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNGKQVYKETCISFIKDFLAKNLIIVIGISFGLAVIEILGLVFSMVLYCQIGNK

Product Description

  • Expression Systems
  • HEK293 cells
  • Tag
  • The construct includes a C-terminal Rho1D4 tag.
  • Protein Format
  • Nanodisc
  • Purity
  • The protein purity is greater than 90% as determined by SDS-PAGE.

Target

  • Target Protein
  • TSPAN8
  • Full Name
  • tetraspanin 8
  • Introduction
  • Tetraspanin-8 (TSPAN8) is a full-length human tetraspanin. Tetraspanin-8 has been demonstrated to play a crucial role in the mediation of signal transduction events, which are known to regulate cell development, activation and motility. Furthermore, TSPAN8 has been shown to be involved in the expression of invasive properties required for tumour progression and melanoma dissemination. Mutations of TSPAN8 have been identified as a contributing factor to a variety of medical diseases, including annular pancreas, diabetes mellitus, as well as pancreas cancer subtype 3a, which makes TSPAN8 a potential target for cancer therapy. The protein is supplied in an MSP-free, copolymer-stabilized native-lipid nanodisc. The preparation uses 2-step purification.
  • Alternative Names
  • CO-029, TM4SF3

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us