Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human FXYD2 (FXYD domain containing ion transport regulator 2) Full Length (CAT#: MPC0503K) Made to Order

This product is a 7.2 kDa Human FXYD2 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • FXYD2
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 7.2 kDa
  • TMD
  • 1
  • Sequence
  • MTGLSMDGGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRF
    RCGGNKKRRQINEDEP

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • FXYD2
  • Full Name
  • FXYD domain containing ion transport regulator 2
  • Introduction
  • This gene encodes a member of the FXYD family of transmembrane proteins. This particular protein encodes the sodium/potassium-transporting ATPase subunit gamma. Mutations in this gene have been associated with Renal Hypomagnesemia-2. Alternatively spliced transcript variants have been described. Read-through transcripts have been observed between this locus and the upstream FXYD domain-containing ion transport regulator 6 (FXYD6, GeneID 53826) locus.
  • Alternative Names
  • HOMG2; ATP1G1; sodium/potassium-transporting ATPase subunit gamma; ATPase, Na+/K+ transporting, gamma 1 polypeptide; Na(+)/K(+) ATPase subunit gamma; sodium pump gamma chain; FXYD2; FXYD domain containing ion transport regulator 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us