Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Mouse Fcer1a (Fc receptor, IgE, high affinity I, alpha polypeptide) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX0927K)

This product is a Mouse Fcer1a membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Mouse
  • Target Protein
  • Fcer1a
  • Protein Length
  • Full Length
  • Protein Class
  • Receptor
  • Molecular Weight
  • 44.7kDa
  • TMD
  • 1
  • Sequence
  • ATEKSVLTLDPPWIRIFTGEKVTLSCYGNNHLQMNSTTKWIHNGTVSEVNSSHLVIVSATVQDSGKYICQKQGLFKSKPVYLNVTQDWLLLQTSADMVLVHGSFDIRCHGWKNWNVRKVIYYRNDHAFNYSYESPVSIREATLNDSGTYHCKGYLRQVKYESDKFRIAVVKAYKCKYYWLQLIFPLLVAILFAVDTGLLLSTEEQFKSVLEIQKTGKYKKVETELLT

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis and SUMO tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE.
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • Fcer1a
  • Full Name
  • Fc receptor, IgE, high affinity I, alpha polypeptide
  • Alternative Names
  • Fcer1a; FcE; Fce1; Fcr-; FcERI; Fce1a; Fcr-5; fcepsilonri; high affinity immunoglobulin epsilon receptor subunit alpha; fc-epsilon RI-alpha; igE Fc receptor subunit alpha; Fc receptor, IgE, high affinity I, alpha polypeptide

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us