Close

SCN2B Membrane Protein Introduction

Introduction of SCN2B

The beta-2 subunit of the mammalian brain voltage-gated sodium channel, known as sodium channel subunit beta-2 (SCN2B) is a 186-residue glycoprotein that contains an extracellular N-terminal domain with similarity to the neural adhesion molecule contactin and a single transmembrane domain. The large alpha subunits of mammalian voltage-gated sodium channels can generate a functional channel when expressed alone in Xenopus oocytes, but the association with the beta-1 or beta-2 subunit has been shown to modify channel function. SCN2B is shown to be expressed in central neurons only, where covalent association with the alpha subunit is correlated with insertion into the cell membrane.

Basic Information of SCN2B
Protein Name Sodium channel subunit beta-2
Gene Name SCN2B
Aliases ATFB14
Organism Homo sapiens (Human)
UniProt ID O60939
Transmembrane Times 1
Length (aa) 215
Sequence MHRDAWLPRPAFSLTGLSLFFSLVPPGRSMEVTVPATLNVLNGSDARLPCTFNSCYTVNHKQFSLNWTYQECNNCSEEMFLQFRMKIINLKLERFQDRVEFSGNPSKYDVSVMLRNVQPEDEGIYNCYIMNPPDRHRGHGKIHLQVLMEEPPERDSTVAVIVGASVGGFLAVVILVLMVVKCVRRKKEQKLSTDDLKTEEEGKTDGEGNPDDGAK

Function of SCN2B Membrane Protein

SCN2B can regulate channel gating, modulate channel expression and localization, and interact with the extracellular matrix molecules. Previous studies have demonstrated that this subunit is distributed in the central and peripheral nervous systems. SCN2B is expressed in hippocampal and cortical neurons, and cerebellar Purkinje neurons. In the dorsal root ganglion (DRG), SCN2B-containing neurons have various cell body sizes. SCN2B is thought to be associated with nociceptive transmission in the sensory ganglion of spinal nerves. However, little is known about the function of SCN2B in other sensory systems. Diseases associated with SCN2B include Brugada syndrome, atrial fibrillation, or sudden infant death syndrome. Among its related pathways are cardiac conduction and L1CAM interactions.

(A) Schematic representation of the α-subunits of cardiac sodium channel, consisting of 4 serially linked homologous domains (DI-DIV), each containing 6 transmembrane segments (S1-S6). (B) The interacting β-subunits and other regulatory proteins are depicted. Fig.1 (A) Schematic representation of the α-subunits of cardiac sodium channel, consisting of 4 serially linked homologous domains (DI-DIV), each containing 6 transmembrane segments (S1-S6). (B) The interacting β-subunits and other regulatory proteins are depicted. (Wilde, 2011)

Application of SCN2B Membrane Protein in Literature

  1. Shimada Y., et al. SCN2B in the rat trigeminal ganglion and trigeminal sensory nuclei. Cellular and Molecular Neurobiology. 2016, 36(8):1399-1408. PubMed ID: 26852328

    This article finds that SCN2B is expressed by TG neurons with various cell body sizes. SCN2B-IR nerve endings are also detected in association with vibrissae, guard hairs, mucosal epithelia and salivary ducts. The distribution and morphology of these endings suggest that they are sensory in nature and derived from the TG.

  2. Baum L., et al. Case-control association study of polymorphisms in the voltage-gated sodium channel genes SCN1A, SCN2A, SCN3A, SCN1B, and SCN2B and epilepsy. Human Genetics. 2014, 133(5):651-9. PubMed ID: 24337656

    This article reveals several associations of SCN genes with epilepsy. Confirmation of the data in independent sets of samples will shed further light on these findings and would allow us to start collecting a list of common genetic variants that could be genotyped to determine the vulnerability of each individual to develop epilepsy.

  3. XiYang Y.B., et al. Sodium channel voltage-gated beta 2 plays a vital role in brain aging associated with synaptic plasticity and expression of COX5A and FGF-2. Molecular Neurobiology. 2016, 53(2):955-67. PubMed ID: 25575679

    This article suggests that only SCN2B displays expressional changes in the prefrontal cortex of SAMP8-8 and SAMP8-12m associated with age-related changes in the human prefrontal cortex.

  4. Riuró H., et al. A missense mutation in the sodium channel β2 subunit reveals SCN2B as a new candidate gene for Brugada syndrome. Human Mutation. 2013, 34(7):961-6. PubMed ID: 23559163

    This article reveals that a missense mutation in the SCN2B gene may be responsible for BrS by decreasing Nav1.5 cell surface expression with the concomitant reduction of INa.

  5. Lu Y., et al. Mutational analysis of SCN2B, SCN3B and SCN4B in a large Chinese Han family with generalized tonic-clonic seizure. Neurological Sciences. 2010, 31(5):675-7. PubMed ID: 20730464

    This article suggests that several sodium channel genes involve the etiology of idiopathic epilepsy, including SCN1A, SCN2A.

SCN2B Preparation Options

Based on our versatile MemDX™ membrane protein production platform, we have achieved significant progress in membrane protein studies. Now, we could offer a series of membrane protein preparation services for worldwide customers in reconstitution forms as well as multiple active formats. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-SCN2B antibody development services.


Aided by our advanced platform, Creative Biolabs has successfully generated many functional membrane proteins for our global customers. We are happy to accelerate the development of our clients’ programs with our one-stop, custom-oriented service. For more detailed information, please feel free to contact us.

Reference

  1. Wilde A A and Brugada R. (2011). Phenotypical manifestations of mutations in the genes encoding subunits of the cardiac sodium channel. Circulation Research. 108(7): 884-97.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us