Close

TMEM184A Membrane Protein Introduction

Introduction of TMEM184A

Transmembrane protein 184A (TMEM184A) is a transmembrane protein composed of 413 amino acids with seven transmembrane domains. TMEM184A is encoded by the TMEM184A gene, which spans the 9.3 kb region on chromosome 5 and was originally identified in mouse cDNA library screen. Mouse TMEM184A has orthologs with many mammalian species, including humans, chimpanzees, dogs and rats, with homology among these homologs exceeding 80%. TMEM184A is predicted to have kinase activity; however, its amino acid sequence does not align to any known domains. Predictive analysis of the TMEM184A protein sequence reveals that the C-terminal region is rich in basic amino acids that can participate in heparin binding. In other regions of the TMEM184A protein, although there are no multiple basic residues in the transmembrane segment, it may also be involved in heparin binding.

Basic Information of TMEM184A
Protein Name Transmembrane protein 184A
Gene Name TMEM184A
Organism Homo sapiens (Human)
UniProt ID Q6ZMB5
Transmembrane Times 7
Length (aa) 413
Sequence MSNVSGILETAGVPLVSANWPQPSPPPAVPAGPQMDHMGNSSQGAPWLFLTSALARGVSGIFVWTALVLTCHQIYLHLRSYTVPQEQRYIIRLLLIVPIYAFDSWLSLLLLGDHQYYVYFDSVRDCYEAFVIYSFLSLCFQYLGGEGAIMAEIRGKPIKSSCLYGTCCLRGMTYSIGFLRFCKQATLQFCLVKPVMAVTTIILQAFGKYHDGDFNVRSGYLYVTLIYNASVSLALYALFLFYFTTRELLRPFQPVLKFLTIKAVIFLSFWQGLLLAILERCGVIPEVETSGGNKLGAGTLAAGYQNFIICVEMLFASVALRYAFPCQVYAEKKENSPAPPAPMQSISSGIRETVSPQDIVQDAIHNFSPAYQHYTQQATHEAPRPGTHPSGGSGGSRKSRSLEKRMLIPSEDL

The Function of TMEM184A Membrane Protein

TMEM184A is present in vascular smooth muscle cells (VSMCs) and endothelial cells (ECs) and is recently identified as the heparin receptor in vascular ECs and VSMCs. In VSMCs, TMEM184A is required for potent anti-proliferative and anti-inflammatory signaling cascades induced by heparin. Heparin binds specifically to TMEM184A and decreases growth-factor-induced MAPK signaling and proliferation. In ECs, TMEM184A is required for heparin-induced expression of dual specificity phosphatase-1 (DUSP1) and subsequent downregulation of MAPK signaling. Heparin-binding results in elevated levels of DUSP1 protein and decreased ERK activity. Therefore, TMEM184A is a heparin receptor that is involved in heparin-induced signaling transduction and mediates the anti-inflammatory response of ECs and VSMCs. The response of VSMC and ECs to heparin includes cell proliferation, ERK pathway activity, and reduction in activation of specific transcription factors. In addition, Furthermore, expression of TMEM184A is specifically upregulated during mouse development and in the Sertoli cells of the testis. Thus, it may mediate signaling events between germ cells and Sertoli cells or between other somatic and Sertoli cells, or mediate regulatory pathways that control the compartmentalization of testicular structures.

Signaling pathway for heparin receptors. Heparin interacts with TMEM184A and leads to an increase in DUSP1 and a decrease in ERK activation. Fig.1 Signaling pathway for heparin receptors. Heparin interacts with TMEM184A and leads to an increase in DUSP1 and a decrease in ERK activation. (Pugh, 2016)

Application of TMEM184A Membrane Protein in Literature

  1. Farwell S.L.N., et al. Novel Heparin Receptor Transmembrane Protein 184a Regulates Angiogenesis in the Adult Zebrafish Caudal Fin. Frontiers in Physiology. 2017, 8:671. PubMed ID: 28936181

    The study demonstrates that Tmem184a is a novel angiogenesis regulator using the adult zebrafish regenerating caudal fin as an in vivo model.

  2. Farwell S.L., et al. Using a GFP-tagged TMEM184A Construct for Confirmation of Heparin Receptor Identity. Journal of Visualized Experiments. 2017, 17:(120). PubMed ID: 28287514

    This report presents a series of experimental protocols based on GFP-TMEM184A constructs expressed in vascular cells that can be easily adapted to other new proteins.

  3. Pugh R.J., et al. Transmembrane Protein 184A Is a Receptor Required for Vascular Smooth Muscle Cell Responses to Heparin. Journal of Biological Chemistry. 2016, 291(10):5326-41. PubMed ID: 26769966

    The data from this study support the discovery that TMEM184A is a heparin receptor in vascular cells.

  4. Svingen T., et al. Sex-specific expression of a novel gene Tmem184a during mouse testis differentiation. Reproduction. 2007, 133(5):983-9. PubMed ID: 17616727

    The results of this study suggest that Tmem184a is expressed only in the Sertoli cells of the developing testicular cord, which mediates gender-specific signals during Sertoli cell differentiation.

  5. Farwell S.L.N., et al. Heparin Decreases in Tumor Necrosis Factor α (TNFα)-induced Endothelial Stress Responses Require Transmembrane Protein 184A and Induction of Dual Specificity Phosphatase 1. Journal of Biological Chemistry. 2016, 291(10):5342-54. PubMed ID: 26769965

    This article demonstrates that TMEM184A acts as a heparin receptor and mediates anti-inflammatory responses in endothelial cells, including reduced JNK and p38 activity.

TMEM184A Preparation Options

Based on our versatile Magic™ membrane protein production platform, we could offer a series of membrane protein preparation services for worldwide customers in reconstitution forms and multiple active formats. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-TMEM184A antibody development services.


In the past years, Creative Biolabs has successfully generated many functional membrane proteins for our global customers. We are happy to accelerate the development of our clients’ programs with our one-stop, custom-oriented service. For more detailed information, please feel free to contact us.

Reference

  1. Pugh R J, et al. (2016). Transmembrane Protein 184A Is a Receptor Required for Vascular Smooth Muscle Cell Responses to Heparin. Journal of Biological Chemistry. 291(10):5326-41.

Online Inquiry

Verification code
Click image to refresh the verification code.

CONTACT US

45-1 Ramsey Road, Shirley, NY 11967, USA
Call us at:
USA: 1-631-381-2994
Europe: 44-207-097-1828
Fax: 1-631-207-8356
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us