Introduction of CHRNB3
The neuronal acetylcholine receptor (nAChR) subunit beta-3 is encoded by the CHRNB3 gene located on chromosome 8p11.21. The subunit beta-3 has a conserved N-terminal extracellular domain followed by three conserved transmembrane domains, a variable cytoplasmic loop, a fourth conserved transmembrane domain, and a short C-terminal extracellular region. CHRNB3 participates in conformational changes that occur with activation and desensitization of nAChRs. After binding acetylcholine, AChRs responds inducting an extensive conformation change which leads to the opening of an ion-conducting channel across the plasma membrane, therefore affecting the channel properties and agonist potency.
| Basic Information of CHRNB3 | |
| Protein Name | Neuronal acetylcholine receptor subunit beta-3 |
| Gene Name | CHRNB3 |
| Aliases | / |
| Organism | Homo sapiens (Human) |
| UniProt ID | Q05901 |
| Transmembrane Times | 4 |
| Length (aa) | 458 |
| Sequence | MLPDFMLVLIVLGIPSSATTGFNSIAENEDALLRHLFQGYQKWVRPVLHSNDTIKVYFGLKISQLVDVDEKNQLMTTNVWLKQEWTDHKLRWNPDDYGGIHSIKVPSESLWLPDIVLFENADGRFEGSLMTKVIVKSNGTVVWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSWTYDGTMVDLILINENVDRKDFFDNGEWEILNAKGMKGNRRDGVYSYPFITYSFVLRRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIVTVFVINVHHRSSSTYHPMAPWVKRLFLQKLPKLLCMKDHVDRYSSPEKEESQPVVKGKVLEKKKQKQLSDGEKVLVAFLEKAADSIRYISRHVKKEHFISQVVQDWKFVAQVLDRIFLWLFLIVSVTGSVLIFTPALKMWLHSYH |
Function of CHRNB3 Membrane Protein
CHRNA6 and CHRNB3 genes coding for the α6 and β3 receptor subunits are located contiguously in a tail to tail configuration on chromosome 8. Their protein products are co-localized in nicotinic receptors in the substantia nigra, ventral tegmental area, striatum, and locus coeruleus. Genome CHRNB3-CHRNA6 gene cluster show a significant association with ND in multiple ethnic populations, including Han Chinese, African Americans, European Americans, and Israelis. Except that, Duane Retraction Syndrome and cocaine dependence are related to CHRNB3.
Fig.1 Overview of the molecular program essential to building mdDA neurons. (Chakrabarty, 2012)
Application of CHRNB3 Membrane Protein in Literature
This article finds that rare variants of CHRNB3 or CHRNA3 may be associated with the risk of alcohol dependence or cocaine dependence.
This article suggests the genetic influence of CHRNB3 and CHRNA6 gene polymorphisms are found in an ND endophenotype (drive) using NDSS subscales, rather than the risk of ND in Korean population.
This article suggests that a variant in CHRNB3-A6 may be involved in the susceptibility to ESCC risk.
This article reveals that locus cocaine and nicotine dependence as well as bipolar disorder may result from multiple variants CHRNB3-A6.
This article suggests that sequence variants within regions harboring nAChR genes and nicotine-metabolizing enzymes are related to smoking behavior.
CHRNB3 Preparation Options
Membrane protein studies have advanced significantly over the past few years. Based on our versatile MemDX™ membrane protein production platform, we could offer a series of membrane protein preparation services for worldwide customers in reconstitution forms as well as multiple active formats. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-CHRNB3 antibody development services.
During the past years, Creative Biolabs has successfully generated many functional membrane proteins for our global customers. We are happy to accelerate the development of our clients’ programs with our one-stop, custom-oriented service. For more detailed information, please feel free to contact us.
Reference
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.