Close

SLC22A1 Membrane Protein Introduction

Introduction of SLC22A1

The solute family 22 member 1 (SLC22A1) is a protein encoded by the gene SLC22A1 in humans. Human OCT1 is encoded by the SLC22A1 gene located on chromosome 6q26 and consists of 11 exons with a span of approximately 37 kb. Multispecific organic cation transporters in the liver, kidneys, intestines and other organs are critical for the elimination of many endogenous small organisms, as well as a large number of pharmaceutical and environmental toxins. This gene is one of three similar cation transport genes in a cluster located on chromosome 6. The encoded protein contains 12 putative transmembrane domains and is a plasma-integrated membrane protein. In this gene, two transcripts encoding two different forms have been discovered, but only longer variants encode a functional transporter. It also requires cells to absorb metformin.

Basic Information of SLC22A1
Protein Name Solute carrier family 22 member 1
Gene Name SLC22A1
Aliases Retinal glutamate transporter, Solute carrier family 1 member 7
Organism Homo sapiens (Human)
UniProt ID O15245
Transmembrane Times 12
Length (aa) 554
Sequence MPTVDDILEQVGESGWFQKQAFLILCLLSAAFAPICVGIVFLGFTPDHHCQSPGVAELSQRCGWSPAEELNYTVPGLGPAGEAFLGQCRRYEVDWNQSALSCVDPLASLATNRSHLPLGPCQDGWVYDTPGSSIVTEFNLVCADSWKLDLFQSCLNAGFLFGSLGVGYFADRFGRKLCLLGTVLVNAVSGVLMAFSPNYMSMLLFRLLQGLVSKGNWMAGYTLITEFVGSGSRRTVAIMYQMAFTVGLVALTGLAYALPHWRWLQLAVSLPTFLFLLYYWCVPESPRWLLSQKRNTEAIKIMDHIAQKNGKLPPADLKMLSLEEDVTEKLSPSFADLFRTPRLRKRTFILMYLWFTDSVLYQGLILHMGATSGNLYLDFLYSALVEIPGAFIALITIDRVGRIYPMAMSNLLAGAACLVMIFISPDLHWLNIIIMCVGRMGITIAIQMICLVNAELYPTFVRNLGVMVCSSLCDIGGIITPFIVFRLREVWQALPLILFAVLGLLAAGVTLLLPETKGVALPETMKDAENLGRKAKPKENTIYLKVQTSEPSGT

Function of SLC22A1 Protein

SLC22A1 is primarily expressed in the human liver and encodes a plasma membrane conveyor, also known as organic cation transporter 1 or OCT1. SLC22A1 is localized to the basolateral (sinusoidal) membrane 21 of the hepatocytes and transports its matrix between the liver and blood. The matrix of SLC22A1 previously described includes a variety of endogenous and pharmacological molecules, which typically have a quaternary amine group and 22 are co-owned by carnitine and acylcarnitamide. The organic cation transporter SLC22A1 is mainly expressed in the liver and is restricted to the basolateral membrane of hepatocytes, which regulates the absorption of matrix from the blood in hepatocytes and promotes drug elimination. Expression of SLC22A1 was also detected in other tissues, including HIV-replicable immune cells such as lymphoid monocytes. The function of SLC22A1 has been shown to have clinically relevant consequences. OCT1 is mainly expressed on the sinusoidal or basolateral membrane of hepatocytes and is thought to play an important role in liver absorption, distribution and excretion of clinically important drugs.

The structure of SLC22A1 Protein. Fig.1 The structure of SLC22A1 Protein.

Application of SLC22A1 Protein in Literatur

  1. Kim H. I., et al. Fine Mapping and Functional Analysis Reveal a Role of SLC22A1 in Acylcarnitine Transport. American Journal of Human Genetics. 2017, 101 (4): 489–502. PubMed ID: 28942964.

    These findings provide a detailed molecular mechanism for the GWAS association of serum acylcarnitines of SLC22A1 to verify the effect of SLC22A1 and its variants on the transport of acylcarnitine by function.

  2. Moss D. M., et al. Interactions of Antiretroviral Drugs with the SLC22A1 (OCT1) Drug Transporter. Frontiers in Pharmacology. 2015, (6): 78. PubMed ID: 25914645.

    These data provide a mechanism for the treatment of antiretroviral drugs, drug-drug interactions, and drug genetic candidate gene selection.

  3. Tantuan S.S., et al. Imatinib Affects the Expression of SLC22A1 in a Non-Linear Concentration-Dependent Manner Within 24 Hours. Medical Science Monitor Basic Research. 2018, (24):59-62. PubMed ID: 29567937.

    The results indicate that imatinib affects the expression of SLC22A1 in a non-linearly concentrated manner within 24 hours.

  4. Moss D.M., et al. Rilpivirine Inhibits Drug Transporters ABCB1, SLC22A1, and SLC22A2 In Vitro. Antimicrobial Agents and Chemotherapy. 2013, 57 (11): 5612–5618. PubMed ID: 24002095.

    These data suggest that SLC22A1 may contribute to variability in contact with rilpivirine and may have the potential to interact with rilpivirine and SLC22A1, SLC22A2 or ABCB1.

  5. Jacobs C., et al. Genetic Polymorphisms and Haplotypes of the Organic Cation Transporter 1 Gene (SLC22A1) in the Xhosa Population of South Africa. Genetics and Molecular Biology. 2014, 37 (2): 350–359. PubMed ID: 25071399.

    This study reports important genetic data that could be useful for future pharmacogenetic studies of drug transporters in the indigenous Sub-Saharan African populations. The study reports important genetic data that may be useful for pharmacogenetic studies of drug transporters in sub-Saharan Africa in the future.

SLC22A1 Preparation Options

To obtain the soluble and functional target protein, the versatile MemDX™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-SLC22A1 antibody development services.


Creative Biolabs' skillful scientists are glad to leverage our expertise and advanced technologies to help you with the member protein research. If you are interested, please feel free to contact us for more details.


All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us