Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3), also known as Glucose transporter type 3, brain (GLUT-3), is a protein that in humans is encoded by the SLC2A3 gene. It belongs to the GLUTs family with the ability to transport glucose across the plasma membranes of mammalian cells.
| Basic Information of SLC2A3 | |
| Protein Name | Solute carrier family 2, facilitated glucose transporter member 3 |
| Gene Name | SLC2A3 |
| Aliases | Glucose transporter type 3, brain, GLUT-3 |
| Organism | Homo sapiens (Human) |
| UniProt ID | P11169 |
| Transmembrane Times | 12 |
| Length (aa) | 496 |
| Sequence | MGTQKVTPALIFAITVATIGSFQFGYNTGVINAPEKIIKEFINKTLTDKGNAPPSEVLLTSLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLIVNLLAVTGGCFMGLCKVAKSVEMLILGRLVIGLFCGLCTGFVPMYIGEISPTALRGAFGTLNQLGIVVGILVAQIFGLEFILGSEELWPLLLGFTILPAILQSAALPFCPESPRFLLINRKEEENAKQILQRLWGTQDVSQDIQEMKDESARMSQEKQVTVLELFRVSSYRQPIIISIVLQLSQQLSGINAVFYYSTGIFKDAGVQEPIYATIGAGVVNTIFTVVSLFLVERAGRRTLHMIGLGGMAFCSTLMTVSLLLKDNYNGMSFVCIGAILVFVAFFEIGPGPIPWFIVAELFSQGPRPAAMAVAGCSNWTSNFLVGLLFPSAAHYLGAYVFIIFTGFLITFLAFTFFKVPETRGRTFEDITRAFEGQAHGADRSGKDGVMEMNSIEPAKETTTNV |
GLUT3 (SLC2A3) was the third glucose transporter to be discovered, first cloned in 1988 from a fetal skeletal muscle cell line, using a GLUT1 cDNA probe and shown to share 64.4% identity with GLUT1. As a member of the GLUTs family, SLC2A3 could facilitate the transport of glucose across the plasma membranes of mammalian cells. It is considered a neuron-specific glucose transporter because of its dominant expression in the brain in various species. However, besides the brain, SLC2A3 is also expressed in tissues with a high demand for glucose such as testis (spermatozoa), placenta, preimplantation embryos, or certain cancer cells and cancer tissues. Studies have shown that a possible trans-regulation effect on SLC2A3 might lead to glucose deficits in dyslexic children that might cause their attenuated mismatch negativity in passive listening tasks.
Fig.1 Structure of SLC2A3.
This article reveals a novel role of the miR-129-5p/SLC2A3 axis in reprogramming the glycometabolism process in GC cells and indicates a potential therapeutic target for the treatment of this disease.
This article finds that the knockdown of GLUT1 and GLUT3 inhibit the abundance of GLUT1, GLUT3, and B-cell lymphoma 2, even the following incubation with curcumin. These data indicate that curcumin protects brain cells from apoptosis and cerebral infarction, predominantly by upregulating GLUT1 and GLUT3.
This article indicates that both common and rare SLC2A3 variation impacting the regulation of neuronal glucose utilization and energy homeostasis may result in neurocognitive deficits known to contribute to attention-deficit/hyperactivity disorder risk.
This article suggests that GLUT3 is a key insulin-sensitive glucose transporter required for insulin-stimulated glucose uptake by Clone 9 cells.
The study aims to investigate the correlation of glucose transporter-1 (Glut-1) and glucose transporter-3 (Glut-3) expression with F-18 FDG uptake in pulmonary inflammatory lesions. It suggests that the expression of Glut-1 and Glut-3 is positively correlated with F-18 FDG uptake. Glut-1 and Glut-3 expressions are high in pulmonary inflammatory lesions, and Glut-3 plays a more important role in F-18 FDG uptake in pulmonary inflammatory lesions.
To provide multiple membrane protein products, we have developed an advanced MemDX™ membrane protein production platform which enables many options, from which we will find you the perfect one. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-SLC2A3 antibody development services.
Creative Biolabs is dedicated to promoting global customers’ programs. In addition to SLC2A3 membrane protein products, we also provide other membrane protein preparation services to meet every client’s specific requirements. To learn more information, please feel free to contact us for more information.
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.