Close

SLC2A3 Membrane Protein Introduction

Introduction of SLC2A3

Solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3), also known as Glucose transporter type 3, brain (GLUT-3), is a protein that in humans is encoded by the SLC2A3 gene. It belongs to the GLUTs family with the ability to transport glucose across the plasma membranes of mammalian cells.

Basic Information of SLC2A3
Protein Name Solute carrier family 2, facilitated glucose transporter member 3
Gene Name SLC2A3
Aliases Glucose transporter type 3, brain, GLUT-3
Organism Homo sapiens (Human)
UniProt ID P11169
Transmembrane Times 12
Length (aa) 496
Sequence MGTQKVTPALIFAITVATIGSFQFGYNTGVINAPEKIIKEFINKTLTDKGNAPPSEVLLTSLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLIVNLLAVTGGCFMGLCKVAKSVEMLILGRLVIGLFCGLCTGFVPMYIGEISPTALRGAFGTLNQLGIVVGILVAQIFGLEFILGSEELWPLLLGFTILPAILQSAALPFCPESPRFLLINRKEEENAKQILQRLWGTQDVSQDIQEMKDESARMSQEKQVTVLELFRVSSYRQPIIISIVLQLSQQLSGINAVFYYSTGIFKDAGVQEPIYATIGAGVVNTIFTVVSLFLVERAGRRTLHMIGLGGMAFCSTLMTVSLLLKDNYNGMSFVCIGAILVFVAFFEIGPGPIPWFIVAELFSQGPRPAAMAVAGCSNWTSNFLVGLLFPSAAHYLGAYVFIIFTGFLITFLAFTFFKVPETRGRTFEDITRAFEGQAHGADRSGKDGVMEMNSIEPAKETTTNV

Function of SLC2A3 Membrane Protein

GLUT3 (SLC2A3) was the third glucose transporter to be discovered, first cloned in 1988 from a fetal skeletal muscle cell line, using a GLUT1 cDNA probe and shown to share 64.4% identity with GLUT1. As a member of the GLUTs family, SLC2A3 could facilitate the transport of glucose across the plasma membranes of mammalian cells. It is considered a neuron-specific glucose transporter because of its dominant expression in the brain in various species. However, besides the brain, SLC2A3 is also expressed in tissues with a high demand for glucose such as testis (spermatozoa), placenta, preimplantation embryos, or certain cancer cells and cancer tissues. Studies have shown that a possible trans-regulation effect on SLC2A3 might lead to glucose deficits in dyslexic children that might cause their attenuated mismatch negativity in passive listening tasks.

Structure of SLC2A3. Fig.1 Structure of SLC2A3.

Application SLC2A3 of Membrane Protein in Literature

  1. Chen D., et al. MicroRNA-129-5p regulates glycolysis and cell proliferation by targeting the glucose transporter SLC2A3 in gastric cancer cells. Frontiers in pharmacology. 2018, 9. PubMed ID: 29867504

    This article reveals a novel role of the miR-129-5p/SLC2A3 axis in reprogramming the glycometabolism process in GC cells and indicates a potential therapeutic target for the treatment of this disease.

  2. Xia M., et al. Curcumin improves diabetes mellitus-associated cerebral infarction by increasing the expression of GLUT1 and GLUT3. Molecular medicine reports. 2018, 17(1):1963-9. PubMed ID: 29257220

    This article finds that the knockdown of GLUT1 and GLUT3 inhibit the abundance of GLUT1, GLUT3, and B-cell lymphoma 2, even the following incubation with curcumin. These data indicate that curcumin protects brain cells from apoptosis and cerebral infarction, predominantly by upregulating GLUT1 and GLUT3.

  3. Merker S., et al. SLC2A3 single-nucleotide polymorphism and duplication influence cognitive processing and population-specific risk for attention-deficit/hyperactivity disorder. Journal of Child Psychology and Psychiatry. 2017, 58(7):798-809. PubMed ID: 28224622

    This article indicates that both common and rare SLC2A3 variation impacting the regulation of neuronal glucose utilization and energy homeostasis may result in neurocognitive deficits known to contribute to attention-deficit/hyperactivity disorder risk.

  4. Defries D.M., et al. GLUT3 is present in Clone 9 liver cells and translocates to the plasma membrane in response to insulin. Biochemical and biophysical research communications. 2016, 477(3):433-9. PubMed ID: 27320866

    This article suggests that GLUT3 is a key insulin-sensitive glucose transporter required for insulin-stimulated glucose uptake by Clone 9 cells.

  5. Wang Z.G., et al. Correlation of Glut-1 and Glut-3 expression with F-18 FDG uptake in pulmonary inflammatory lesions. Medicine. 2016, 95(48). PubMed ID: 27902598

    The study aims to investigate the correlation of glucose transporter-1 (Glut-1) and glucose transporter-3 (Glut-3) expression with F-18 FDG uptake in pulmonary inflammatory lesions. It suggests that the expression of Glut-1 and Glut-3 is positively correlated with F-18 FDG uptake. Glut-1 and Glut-3 expressions are high in pulmonary inflammatory lesions, and Glut-3 plays a more important role in F-18 FDG uptake in pulmonary inflammatory lesions.

SLC2A3 Preparation Options

To provide multiple membrane protein products, we have developed an advanced MemDX™ membrane protein production platform which enables many options, from which we will find you the perfect one. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-SLC2A3 antibody development services.


Creative Biolabs is dedicated to promoting global customers’ programs. In addition to SLC2A3 membrane protein products, we also provide other membrane protein preparation services to meet every client’s specific requirements. To learn more information, please feel free to contact us for more information.


All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us