Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsWith over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications. Highlights
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
HighlightsWith deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
HighlightsGet a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
HighlightsIntroduction of FZD2
FZD2 is encoded by the FZD2 gene. It belongs to the G-protein-coupled receptor (GPCR) family which has been largely studied in the past few decades. It presents numerous possibilities for various therapeutic applications. It is one of the ten subtypes of frizzled family (FZD1, FZD2, FZD3, FZD4, FZD5, FZD6, FZD7, FZD8, FZD9, FZD10). FZD2 is a seven-transmembrane domain protein with the length of 565 amino acids.
| Basic Information of FZD2 | |
| Protein Name | Frizzled-2 |
| Gene Name | FZD2 |
| Aliases | Fz2, fz-2, fzE2, hFz2 |
| Organism | Homo sapiens (Human) |
| UniProt ID | Q14332 |
| Transmembrane Times | 7 |
| Length (aa) | 565 |
| Sequence |
MRPRSALPRLLLPLLLLPAAGPAQFHGEKGISIPDHGFCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAG LEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLEQAIPPCRSICERARQGCEALMNKFGFQWPERLRCEH FPRHGAEQICVGQNHSEDGAPALLTTAPPPGLQPGAGGTPGGPGGGGAPPRYATLEHPFHCPRVLKVPSY LSYKFLGERDCAAPCEPARPDGSMFFSQEETRFARLWILTWSVLCCASTFFTVTTYLVDMQRFRYPERPI IFLSGCYTMVSVAYIAGFVLQERVVCNERFSEDGYRTVVQGTKKEGCTILFMMLYFFSMASSIWWVILSL TWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQIDGDLLSGVCFVGLNSLDPLRGFVLAPL FVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLERLMVRIGVFSVLYTVPATIVIACYFYEQAFREHW ERSWVSQHCKSLAIPCPAHYTPRMSPDFTVYMIKYLMTLIVGITSGFWIWSGKTLHSWRKFYTRLTNSRH GETTV |
Function of FZD2 Membrane Protein
Frizzled is a family of G-protein-coupled receptor (GPCR) proteins which has been served as receptors in various signaling pathways, such as Wnt signaling pathway. FZD2 belongs to the Frizzled family and plays key roles in cell proliferation, governing cell polarity, the formation of neural synapses, embryonic development, and some other processes in developing and adult organisms. Among all FZD subtypes, secreted Frizzled-related protein 1 (SFRP1) is able to interact with FZD2 so that guide growth cone movement. In addition, the disease associated with FZD2 include Omodysplasia and Omodysplasia 2. In recent years, several studies have shown that FZD2 enables the tumor biology regulation in a complex manner and gene FZD2 might inhibit cell growth and migration in various tumor types.
Fig.1 Structure of FZD2 membrane protein.
Application of FZD2 Membrane Protein in Literature
This article reports that both NXN and FZD2 are relevant protein partners in the WNT5A interactome and play important roles in skeletal development. The genetic heterogeneity of robinow syndrome is based on WNT signaling perturbations.
This article reveals that the heterozygous nonsense FZD2 mutation impairing Wnt signaling and induces the OMOD2 or Robinow syndrome-like phenotype. The FZD2 mutation has been identified in a family with AD omodysplasia.
This article reports that the changes of FZD2 mRNA expression in a certain time after contusion might be a basis to estimate wound age by combined multi-indicators.
This article reveals that the FZD2 regulates tumor biology in a complex manner. This research suggests that FZD2 might be a tumor suppressor gene inhibits cell growth and migration in SACCs.
FZD2 Preparation Options
To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-FZD2 antibody development services.
Creative Biolabs has been a long-term expert in the field of membrane protein preparation. Our services can be tailor-designed to meet your specific needs. If you are interested in our membrane proteins preparation service, please do not hesitate to contact us for more details.
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.
