Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsWith over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications. Highlights
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
HighlightsWith deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
HighlightsGet a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
HighlightsIntroduction of FZD4
FZD4 is encoded by the FZD4 gene which belongs to the G-protein-coupled receptor (GPCR) family. In the past few decades, the GPCR family has been largely studied because of its numerous possibilities for therapeutic applications. It is one of the ten subtypes of the frizzled family (FZD1, FZD2, FZD3, FZD4, FZD5, FZD6, FZD7, FZD8, FZD9, FZD10). Among all FZD subtypes, FZD4 spans a total of 7392 nucleotides and encodes the protein with 537 amino acids. This protein contains seven transmembrane domains and the N-terminal cysteine-rich domain.
| Basic Information of FZD4 | |
| Protein Name | Frizzled-4 |
| Gene Name | FZD4 |
| Aliases | Fz4, EVR1, FEVR, Fz-4, FzE4, GPCR, hFz4, CD344, FZD4S |
| Organism | Homo sapiens (Human) |
| UniProt ID | Q9ULV1 |
| Transmembrane Times | 7 |
| Length (aa) | 537 |
| Sequence |
MAWRGAGPSVPGAPGGVGLSLGLLLQLLLLLGPARGFGDEEERRCDPIRISMCQNLGYNVTKMPNLVGHE LQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWP ESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEECHSVGTNSDQYIWVKRSLNCVLKCGYDAGL YSRSAKEFTDIWMAVWASLCFISTAFTVLTFLIDSSRFSYPERPIIFLSMCYNIYSIAYIVRLTVGRERI SCDFEEAAEPVLIQEGLKNTGCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIA AWAIPAVKTIVILIMRLVDADELTGLCYVGNQNLDALTGFVVAPLFTYLVIGTLFIAAGLVALFKIRSNL QKDGTKTDKLERLMVKIGVFSVLYTVPATCVIACYFYEISNWALFRYSADDSNMAVEMLKIFMSLLVGIT SGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGSETVV |
Function of FZD4 Membrane Protein
Frizzled family, encoded by the Frizzled genes, is implicated in a series of cellular processes including cell polarity control, cell fate determination, and malignant transformation. As the only representative of frizzled family members, it presents similar binding function but different construction with wingless type proteins. The FZD4 plays an important role in the wingless type MMTV integration site signaling pathway as a positive regulator. The FZD4 mRNA have been detected in various human tissues especial in fetal kidney, skeletal muscle, adult heart, and ovary. Moreover, FZD4 is homologous to FZD9 and FZD10. It has been reported that mutant FZD4 associated with exudative vitreoretinopathy by disrupting retinal angiogenesis. Among its related pathways are ectoderm differentiation and mesodermal commitment pathway.
Fig.1 Structure of FZD4 membrane protein.
Application of FZD4 Membrane Protein in Literature
This article reports that the expression levels of miR-3127-5p and FZD4 are negatively associated with tumors and the down regulation of miR-3127-5p can promote EMT so that presents potential to be a therapeutic target for NSCLC metastasis.
This article reveals that the expression of MiR-505 in cervical cancer cells is low and has been served as the potential cancer inhibitor and prognostic factor. FZD4 presents dramatic regulatory function in cervical cancer.
This article reports that the mutation of FZD4 alleles might be associated with recessive rather than a dominant disease in some case.
Authors in this group focus on the familial exudative vitreoretinopathy (FEVR) which is a rare hereditary disorder with the characterization of failed peripheral retinal vascularization. The mutation of FZD4, LRP5, and TSPAN12 are associated with the autosomal inheritance form of FEVR.
This article focuses on the retinopathy of prematurity (ROP) which is a complex disease with a genetic predisposition. The author has found six possible mutations of FZD4 or LRP5 in advanced ROP patients.
FZD4 Preparation Options
In order to get the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-FZD4 antibody development services.
Based on our extensive experience and advanced platforms, Creative Biolabs is always dedicated to assisting our clients with the most satisfactory membrane protein antibody related services. If you are interested in our service, please do not hesitate to contact us for more details.
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.
