Close

FZD8 Membrane Protein Introduction

Introduction of FZD8

FZD8 is encoded by the FZD8 gene. FZD8 is a human homologous mouse Frizzled-8, and there is no intron within the FZD8 gene. FZD8 encodes a 694 amino acid polypeptide with a coil-like cysteine-rich domain, seven transmembrane domains and a C-terminal Ser/Thr-X-Val motif. In human FZD family, FZD8 has the highest homology with FZD5. Studies have found that 4.0-kb FZD8 mRNA can be detected in fetal kidney and brain as well as adult kidney, heart, pancreas, and skeletal muscle. The FZD8 gene is mapped to human chromosome 10p11.2 by fluorescence in situ hybridization. In human cancer cell lines, FZD8 is expressed relatively higher in HeLa S3 (cervical cancer) and A549 (lung cancer).

Basic Information of FZD8
Protein Name Frizzled-8 (Fz-8) (hFz8)
Gene Name FZD8
Aliases FZD8, FZ-8, hFZ8, frizzled class receptor 8
Organism Homo sapiens (Human)
UniProt ID Q9H461
Transmembrane Times 7
Length (aa) 694
Sequence MEWGYLLEVTSLLAALALLQRSSGAAAASAKELACQEITVPLCKGIGYNYTYMPNQFNHD
TQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAP
LMRQYGFAWPDRMRCDRLPEQGNPDTLCMDYNRTDLTTAAPSPPRRLPPPPPGEQPPSGS
GHGRPPGARPPHRGGGRGGGGGDAAAPPARGGGGGGKARPPGGGAAPCEPGCQCRAPMVS
VSSERHPLYNRVKTGQIANCALPCHNPFFSQDERAFTVFWIGLWSVLCFVSTFATVSTFL
IDMERFKYPERPIIFLSACYLFVSVGYLVRLVAGHEKVACSGGAPGAGGAGGAGGAAAGA
GAAGAGAGGPGGRGEYEELGAVEQHVRYETTGPALCTVVFLLVYFFGMASSIWWVILSLT
WFLAAGMKWGNEAIAGYSQYFHLAAWLVPSVKSIAVLALSSVDGDPVAGICYVGNQSLDN
LRGFVLAPLVIYLFIGTMFLLAGFVSLFRIRSVIKQQDGPTKTHKLEKLMIRLGLFTVLY
TVPAAVVVACLFYEQHNRPRWEATHNCPCLRDLQPDQARRPDYAVFMLKYFMCLVVGITS
GVWVWSGKTLESWRSLCTRCCWASKGAAVGGGAGATAAGGGGGPGGGGGGGPGGGGGPGG
GGGSLYSDVSTGLTWRSGTASSVSYPKQMPLSQV

Function of FZD8 Membrane Protein

FZD8 is a receptor for Wnt protein. It is also a component of the Wnt-Fzd-LRP5-LRP6 complex that triggers β-catenin signaling by inducing receptor-ligand complexes to aggregate into ribosome-sized reporters. The β-catenin standard signaling pathway leads to the activation of dishevelled proteins, inhibition of GSK-3 kinase, nuclear accumulation of β-catenin, and activation of Wnt target genes. Its signal transduction pathway involves interaction with the G protein. It may be involved in the transduction and intercellular transmission of polarity information in tissue morphogenesis anddifferentiated tissues. The up-regulation of FZD8 by activating the β-catenin-TCF pathway plays a key role in the treatment of human cancers.

Structure of FZD8membrane protein. Fig.1 Structure of FZD8membrane protein.

Application of FZD8 Membrane Protein in Literature

  1. Murillo-Garzon V., et al.Frizzled-8 integrates Wnt-11 and transforming growth factor-beta signaling in prostate cancer.NatCommun.2018, 9(1):1747. PubMed ID: 29717114

    This article reports that FZD8 is the major Wnt-1 1 receptor that integrates Wnt-1 1 and TGF-β signaling to promote EMTin prostate cancer, and its mRNA is upregulated in a variety of prostate cancer data sets as well as in theinvitro and in vivometastatic cancer cell lines.

  2. Yang Q., et al. Frizzled 8 promotes the cell proliferation and metastasis of renal cell carcinoma.Oncotarget. 2017, 8(45): 78989-79002. PubMed ID: 29108281

    This article reveals that FZD8 is involved in the regulation of non-canonical Wnt signaling pathways, and the expression of FZD8 may play an important role in the proliferation and metastasis of RCC, and it may serve as a speculative and promising drug target for human RCC therapy.

  3. Xu J., et al. Characterization and expression pattern of a novel Frizzled 8 receptor gene in Schistosomajaponicum.Parasitol Int. 2017, 66(5):522-528.PubMed ID:28385590

    The article points out that FZD8 protein is present in almost all tissues of Schistosomajaponicum. FZD8-mediated Wnt signaling pathway may be involved in the regulation of tissue formation and organogenesis in Schistosomiasis, and play an important role in regulating the further growth of males and females.

  4. Wang J., et al. MicroRNA-520b Suppresses Proliferation, Migration, and Invasion of Spinal Osteosarcoma Cells viaDownregulation of Frizzled-8. Oncol Res. 2017, 25(8):1297-1304.PubMed ID:28247840

    The article tells us that miR-520b inactivates the Wnt/β-catenin pathway by down-regulating FZD8. MiR-520b inhibits cell proliferation, migration,and invasion by downregulating FZD8 through inactivation of Wnt/β-catenin pathway, thus providing a new therapeutic target for spinal cord OS.

  5. Xu L., et al. MicroRNA-375 suppresses human colorectal cancer metastasis by targeting Frizzled 8 Send to Oncotarget.2016, 7(26):40644-40656. PubMed ID:27276676

    The article believes that FZD8 may become a new target to inhibit the metastasis of CRC tumors. FZD8 is a direct target of miR-375 in CRC. MiR-375 negatively regulates Wnt/β-catenin signaling through the inhibition of FZD8, and miR-375 can function as a tumor-suppressing microRNA through direct action on FZD8.

FZD8 Preparation Options

To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project.Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-FZD8 antibody development services.


As a forward-looking research institute as well as a leading customer service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.

Online Inquiry

Verification code
Click image to refresh the verification code.

CONTACT US

45-1 Ramsey Road, Shirley, NY 11967, USA
Call us at:
USA: 1-631-381-2994
Europe: 44-207-097-1828
Fax: 1-631-207-8356
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us