Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsWith over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications. Highlights
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
HighlightsWith deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
HighlightsGet a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
HighlightsIntroduction of FZD5
FZD5 is a 7-transmembrane receptor belonging to the frizzled family. Encoded by the FZD5 gene in human, it is one of the ten subtypes of the frizzled family (FZD1, FZD2, FZD3, FZD4, FZD5, FZD6, FZD7, FZD8, FZD9, FZD10). FZD5 belongs to the G-protein-coupled receptor (GPCR) family which has been studied well in recent years because of its great potential for therapeutic applications. The FZD5 protein has been served as the receptor for the WNT5A ligand and plays an important role in angiogenesis.
| Basic Information of FZD5 | |
| Protein Name | Frizzled-5 |
| Gene Name | FZD5 |
| Aliases | HFZ5, C2orf31 |
| Organism | Homo sapiens (Human) |
| UniProt ID | Q13467 |
| Transmembrane Times | 7 |
| Length (aa) | 585 |
| Sequence |
MARPDPSAPPSLLLLLLAQLVGRAAAASKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQF WPLVEIQCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLG RDAEVLCMDYNRSEATTAPPRPFPAKPTLPGPPGAPASGGECPAGGPFVCKCREPFVPILKESHPLYNKV RTGQVPNCAVPCYQPSFSADERTFATFWIGLWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLC VSLGFLVRLVVGHASVACSREHNHIHYETTGPALCTIVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGN EAIAGYAQYFHLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLL AGFVSLFRIRSVIKQGGTKTDKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEAALTCACPGHD TGQPRAKPEYWVLMLKYFMCLVVGITSGVWIWSGKTVESWRRFTSRCCCRPRRGHKSGGAMAAGDYPEAS AALTGRTGPPGPAATYHKQVSLSHV |
Function of FZD5 Membrane Protein
Frizzled family plays key roles in cell proliferation, governing cell polarity, the formation of neural synapses, embryonic development, and some other processes in developing and adult organisms. It has been reported that monocyte-secreted WNT5A interacts with FZD5 in microvascular endothelial cells and induces angiogenesis through tissue factor signaling. Its related pathways contain ectoderm differentiation and mesodermal commitment pathway. It has been also reported that the Wnt-Frizzled signaling presents the conserved role in ocular development. In addition, the diseases associated with FZD5 include coloboma of optic nerve and coloboma of the eyelid.
Fig .1 Structure of FZD5.
Application of FZD5 Membrane Protein in Literature
Recently, it has been proved that circular RNAs plays an important role in the progression of human cancers. This article reports that circ_0067934 enables the proliferation, migration, and invasion of HCC cells via the miR-1324c inhibition and FZD5/Wnt/b-catenin signaling pathway. In summary, this signaling axis might be served as the potential therapeutic target for HCC intervention.
This article reveals that the pro-angiogenic role of FZD5 is accomplished by the endothelial tubule formation, cell cycle progression, and migration, and the repression of PKC/Ets1-mediated transcription of Flt1 and Angpt2.
Authors in this group reveal that the down regulation of microRNA-216b in diabetic MMECs enhances the angiogenesis in diabetic angiopathy via the inverse regulation on FZD5.
Ocular coloboma is the common eye malformation caused by the incomplete fusion of the optic fissure during development. This article revealed the conserved role of Wnt-Frizzled signaling in ocular development.
This article first demonstrated that BML-111 suppresses the Wnt5a/FZD5/CaMKII signaling pathway in sepsis which mediates the inflammatory reactions. In summary, BML-111 presents potential functions in sepsis.
FZD5 Preparation Options
In order to obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-FZD5 antibody development services.
Based on our extensive experience and advanced platforms, Creative Biolabs has the capability to enable you to free up your time for membrane protein preparation. If you are interested in our services, please do not hesitate to contact us for more details.
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.
