LHFPL5, LHFPL tetraspan subfamily member 5, is a protein that in humans is encoded by the LHFPL5 gene. This gene is a member of the lipoma HMGIC fusion partner (LHFP) gene family, which is a subset of the superfamily of tetraspan transmembrane protein encoding genes. In the inner ear, it may be a component of the hair cell's mechanotransduction machinery that functionally couples PCDH15 to the transduction channel.
| Basic Information of LHFPL5 | |
| Protein Name | LHFPL tetraspan subfamily member 5 protein |
| Gene Name | LHFPL5 |
| Aliases | Lipoma HMGIC fusion partner-like 5 protein, Tetraspan membrane protein of hair cell stereocilia, TMHS |
| Organism | Homo sapiens (Human) |
| UniProt ID | Q8TAF8 |
| TransmLHFPL5rane Times | 4 |
| Length (aa) | 219 |
| Sequence | MVKLLPAQEAAKIYHTNYVRNSRAVGVMWGTLTICFSVLVMALFIQPYWIGDSVNTPQAGYFGLFSYCVGNVLSSELICKGGPLDFSSIPSRAFKTAMFFVALGMFLIIGSIICFSLFFICNTATVYKICAWMQLAAATGLMIGCLVYPDGWDSSEVRRMCGEQTGKYTLGHCTIRWAFMLAILSIGDALILSFLAFVLGYRQDKLLPDDYKADGTEEV |
LHFPL5 can regulate transducer channel conductance and it is required for fast channel adaptation. It has been reported that mutations in this gene result in deafness in humans. Also, it is proposed to function in hair bundle morphogenesis. LHFPL5 is already present in the MET apparatus at P0 but requires PCDH15 at P3 to remain there. Shaft/ankle link localization suggests that LHFPL5 can interact with link proteins other than PCDH15. In addition, LHFPL5 is important for the normal function of the human cochlea. Moreover, LHFPL5 is one of the components of the sensory mechanotransduction machinery in stereocilia. In hair cells, it is responsible for sensory transduction. Furthermore, LHFPL5 mutation is associated with hearing the loss in the Pakistani population and deafness in humans.
Fig.1 Tetraspan membrane protein in hair cell stereocilia (TMHS)/LHFPL5 bind to PCDH15 and are constituents of the sensory mechanoelectrical transduction (MET) machinery. (Qiu, 2018)
This article indicates that LHFPL5 is already present in the MET apparatus at P0 but requires PCDH15 at P3 to remain there. Shaft/ankle link localization suggests that it can interact with link proteins other than PCDH15.
This article shows that LHFPL5 is essential for normal function of the human cochlea.
This study suggests that LHFPL5 is one of the components of the sensory mechanotransduction machinery in stereocilia which is responsible for sensory transduction in hair cells.
This article demonstrates that LHFPL5 is identified as one of the deafness autosomal recessive (DFNB) genes. The custom capture panel in this study provides an efficient and comprehensive diagnosis for known deafness genes in small families.
This article indicates that LHFPL5 mutation is associated with hearing the loss in the Pakistani population. In addition, this study highlights the fact that compound heterozygous mutations, although rare, can occur in consanguineous families.
We provide custom membrane protein preparation services for worldwide customers. Leveraging by our advanced MemDX™ membrane protein production platform, we are able to present target membrane proteins in multiple active formats. Our professional scientists are happy to help you find an ideal method and make your project a success. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-LHFPL5 antibody development services.
Creative Biolabs provides high-quality membrane protein preparation service to facilitate the development of worldwide customer’s research. During the past years, we have successfully established a powerful MemDX™ membrane protein platform which enables us to provide a series of membrane protein preparation services. For more detailed information, please feel free to contact us.
Reference
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.