Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsWith over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications. Highlights
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
HighlightsWith deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
HighlightsGet a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
HighlightsSerine protease hepsin, also known as transmembrane protease serine 1 or HPN, is a cell surface-expressed trypsin-like serine protease which is predominantly expressed in normal human liver. HPN in human is encoded by the HPN gene. And it belongs to the type II transmembrane serine protease (TTSP) family. Specifically, HPN contains an N-terminal cytoplasmic domain, a transmembrane domain, and an extracellular portion composed of a scavenger receptor-like cysteine-rich domain (SRCR domain) and a C-terminal protease domain with a trypsin-like fold (S1 domain).
| Basic Information of HPN | |
| Protein Name | Serine protease hepsin |
| Gene Name | HPN |
| Aliases | Transmembrane protease serine 1 |
| Organism | Homo sapiens (Human) |
| UniProt ID | P05981 |
| TransmHPNrane Times | 1 |
| Length (aa) | 417 |
| Sequence | MAQKEGGRTVPCCSRPKVAALTAGTLLLLTAIGAASWAIVAVLLRSDQEPLYPVQVSSADARLMVFDKTEGTWRLLCSSRSNARVAGLSCEEMGFLRALTHSELDVRTAGANGTSGFFCVDEGRLPHTQRLLEVISVCDCPRGRFLAAICQDCGRRKLPVDRIVGGRDTSLGRWPWQVSLRYDGAHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVAQASPHGLQLGVQAVVYHGGYLPFRDPNSEENSNDIALVHLSSPLPLTEYIQPVCLPAAGQALVDGKICTVTGWGNTQYYGQQAGVLQEARVPIISNDVCNGADFYGNQIKPKMFCAGYPEGGIDACQGDSGGPFVCEDSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREWIFQAIKTHSEASGMVTQL |
Serine protease hepsin plays a role in cell growth and maintenance of cell morphology. And it is involved in the proteolytic processing of ACE2. It has been also shown that hepsin may mediate the proteolytic cleavage of urinary UMOD which is required for UMOD polymerization. Hepsin is prominently expressed in the human liver and several types of tumors, including prostate cancer, endometrial cancer, and renal cell carcinoma. It has been identified as one of the most highly up-regulated proteases in prostate cancer and immunohistochemical staining indicates its strong expression in late-stage tumors and metastatic bone lesions. Overexpression of hepsin in the prostate epithelium weakens the epithelial-stromal adhesion and disrupts the basement membrane. In preclinical studies using prostate cancer models, it has been shown that hepsin may play a role in invasive cancer growth, cancer progression. Hepsin has been also supposed to promote primary prostate cancer metastasis.
Fig.1 Structure of Serine Protease Hepsin.
Authors in this article considered the RIPL-NLCs as good candidates for Hpn-selective drug targeting with a high loading capacity of hydrophobic drug molecules.
Authors in this article described how to establish a 3D mammary epithelial culture in an exogenous basement membrane-free egg white matrix and provided a protocol for quantitative analysis of the impact of hepsin on laminin-332 and its hemidesmosomal receptor α6-integrin by means of confocal microscopy imaging.
This article focused on rapidly developing potent and selective inhibitors of hepsin, using integrated design, synthesis, and screening platform.
This article attempted to study the potential functional role of serum Growth Differentiation Factor 15 (GDF15), Hepsin (HPN), and Matrix Metalloproteinase-7 (MMP7) in bipolar disorder (BP).
This article discussed design strategy, structure-activity relationship (SAR), and binding mode of the four classes of hepsin inhibitors.
Our versatile Magic™ membrane protein production platform enables many flexible options, from which you can always find a better match for your particular projects. To prepare the soluble and functional target protein of your interest, our experienced scientists present robust reconstitution forms as well as multiple active formats for membrane proteins. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-HPN antibody development services.
As a reliable partner of the top global pharma companies and research agencies, Creative Biolabs has worked all out in the field of membrane protein preparation to provide the largest and most diverse portfolio of standard and custom professional membrane protein preparation services. Please feel free to contact us for more details and technical support.
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.
