Close

SLC50A1 Membrane Protein Introduction

Introduction of SLC50A1

SLC50A1 (solute carrier family 50, member 1), also known as sugar transporter SWEET1 or stromal cell protein (SCP), is a Na+-independent anion exchanger (AE). It belongs to the Slc4a family of Cl-/HCO3- exchangers that contain products of 11 human genes (SLC4A1-5; A6, A7-11). They are composed of Na+-independent anion exchangers (AEs) SLC4A1 (AE1), SLC4A2 (AE2), SLC4A3 (AE3), and SLC50A1 (AE4) and Na+-coupled bicarbonate transporters (NBCs). There are structural and functional similarities between all transporters of the SLC4 gene family. AE polypeptides consist of three distinct domains: a hydrophilic cytoplasmic N-terminal domain of ~400-700 amino acids, a hydrophobic transmembrane domain of ~500 amino acids, and a cytoplasmic C-terminal consisting of ~30-100 amino acids.

Basic Information of SLC50A1
Protein Name Sugar transporter SWEET1
Gene Name SLC50A1
Aliases RAG1AP1, SCP
Organism Homo sapiens (Human)
UniProt ID Q9BRV3
Transmembrane Times 7
Length (aa) 221
Sequence MEAGGFLDSLIYGACVVFTLGMFSAGLSDLRHMRMTRSVDNVQFLPFLTTEVNNLGWLSYGALKGDGILIVVNTVGAALQTLYILAYLHYCPRKRVVLLQTATLLGVLLLGYGYFWLLVPNPEARLQQLGLFCSVFTISMYLSPLADLAKVIQTKSTQCLSYPLTIATLLTSASWCLYGFRLRDPYIMVSNFPGIVTSFIRFWLFWKYPQEQDRNYWLLQT

Function of SLC50A1 Membrane Protein

SLC50A1 (AE4) is a membrane protein involved in anion exchange. It has been found to be expressed on the apical membrane of gastric mucous cells and duodenal epithelial cells in mouse, rabbit, and human. However, the function of AE4 in HCO3- secretion and chloride absorption in gastric and duodenal epithelial cells is not clear. Early research found that AE4 is a Na+-independent anion exchanger. However, a recent study revealed that it is an electroneutral monovalent cation-dependent Cl-/HCO3- exchanger that mediates Cl-/HCO3- exchange activity in the presence of K+ as well as Cs+, Li+, and Rb+. SLC4 family members have been shown to play an important role in exocrine gland fluid secretion by promoting intracellular Cl- accumulation. Indeed. the expression of AE4 is found in secretory acinar cells such as salivary gland acinar cells and involved in the regulation of intracellular Cl- accumulation in exchange for KHCO3- efflux. Mice lacking AE4 Cl-/HCO3- exchangers will reduce HCO3--dependent Cl- uptake and thus decrease saliva secretion. These suggest AE4 appears to play an important role in fluid secretion.

SLC50A1 Membrane Protein IntroductionFig.1 Na+-dependent HCO3-/HCO3- exchange under low Cl- concentrations. (Peña-Münzenmayer, 2016)

Application of SLC50A1 Membrane Protein in Literature

  1. Peña-Münzenmayer G., et al. Ae4 (SLC50A1) is an electroneutral monovalent cation-dependent Cl-/HCO3- exchanger. Journal of General Physiology. 2016, 147(5): 423-436. PubMed ID: 27114614

    The study identifies SLC50A1 as an electroneutral Cl(-)/nonselective cation-HCO3(-) exchanger and demonstrates AE4 promotes Cl(-) influx in exchange for K(+)(Na(+)) and HCO3(-) ions in secretory cells.

  2. Peñamünzenmayer G., et al. Ae4 (SLC50A1) Anion Exchangers Drive Cl- Uptake-dependent Fluid Secretion by Mouse Submandibular Gland Acinar Cells. Journal of Biological Chemistry. 2015, 290(17): 10677-10688. PubMed ID: 25745107

    The research makes a conclusion that AE4 is functionally expressed in submandibular acinar cells and involved in the cAMP-dependent regulation of fluid secretion.

  3. Vera-Sigüenza E., et al. A Mathematical Model Supports a Key Role for Ae4 (SLC50A1) in Salivary Gland Secretion. Bulletin of Mathematical Biology. 2018, 80(2): 255-282. PubMed ID: 29209914

    In this study, a mathematical model of a salivary gland acinar cell is used to investigate the role of Ae2 (Slc4a2) and Ae4 (SLC50A1) in saliva secretion and the results show that Ae4 plays an important role in saliva secretion.

  4. Purkerson J.M., et al. Insights into acidosis-induced regulation of SLC26A4 (pendrin) and SLC50A1 (AE4) transporters using three-dimensional morphometric analysis of β-intercalated cells. Am J Physiol Renal Physiol. 2014, 307(5): F601-11. PubMed ID: 24990900

    The aim of this study is to investigate the three-dimensional (3-D) expression and distribution of SLC26A4 and AE4 in β-intercalated cells (β-ICs) of the rabbit cortical collecting duct. And the results show that acidosis reduces AE4 expression in β-ICs and diminishes pendrin in apical recycling endosomes.

  5. Kurth I., et al. The forkhead transcription factor Foxi1 directly activates the AE4 promoter. Biochemical Journal. 2006, 393(1): 277-83. PubMed ID: 16159312

    The article demonstrates that AE4 promoter appears to be a direct target of forkhead transcription factor Foxi1.

SLC50A1 Preparation Options

Based on the versatile MemDX™ membrane protein production platform, Creative Biolabs can help you to obtain the best soluble and functional target protein to make your project a success. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-SLC50A1 antibody development services.


As a forward-looking biotech company as well as a leading custom service provider in the field of membrane protein, Creative Biolabs has won a good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.

Reference

  1. Peña-Münzenmayer G, et al. (2016). Ae4 (SLC50A1) is an electroneutral monovalent cation-dependent Cl-/HCO3- exchanger. Journal of General Physiology. 147(5): 423-436.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us